Recombinant Human NT5C2 Protein (Mutant), N-6×His-tagged
Cat.No. : | NT5C2-2490HM |
Product Overview : | Recombinant Human NT5C2 Protein (Mutant) with N-6×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides. |
Molecular Mass : | ~67.7 kDa, reducing conditions |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLANLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHA KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDAAFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM Tris-HCl buffer (pH8.0) containing 30 % glycerol 0.1M NaCl, 1mM DTT, 0.1mM PMSF. |
Gene Name | NT5C2 5'-nucleotidase, cytosolic II [ Homo sapiens (human) ] |
Official Symbol | NT5C2 |
Synonyms | NT5C2; 5'-nucleotidase, cytosolic II; GMP; NT5B; PNT5; SPG45; SPG65; cN-II; cytosolic purine 5'-nucleotidase; 5'-nucleotidase (purine), cytosolic type B; IMP-specific 5'-NT; cytosolic IMP/GMP-specific 5'-nucleotidase; cytosolic nucleoside phosphotransferase 5'N; epididymis secretory sperm binding protein; high Km 5'-nucleotidase; spastic paraplegia 45 (autosomal recessive); EC 2.7.1.77; EC 3.1.3.5; EC 3.1.3.99 |
Gene ID | 22978 |
mRNA Refseq | NM_012229 |
Protein Refseq | NP_036361 |
MIM | 600417 |
UniProt ID | P49902 |
◆ Recombinant Proteins | ||
NT5C2-1381H | Recombinant Human NT5C2, GST-tagged | +Inquiry |
NT5C2-2490H | Recombinant Human 5'-Nucleotidase, Cytosolic II, His-tagged | +Inquiry |
NT5C2-258H | Recombinant Human NT5C2 protein, GST-tagged | +Inquiry |
NT5C2-2930R | Recombinant Rhesus Macaque NT5C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NT5C2-3473H | Recombinant Human NT5C2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C2-3677HCL | Recombinant Human NT5C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C2 Products
Required fields are marked with *
My Review for All NT5C2 Products
Required fields are marked with *