Recombinant Human NT5C2 Protein (Mutant), N-6×His-tagged

Cat.No. : NT5C2-2490HM
Product Overview : Recombinant Human NT5C2 Protein (Mutant) with N-6×His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides.
Molecular Mass : ~67.7 kDa, reducing conditions
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLANLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHA KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDAAFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.5 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM Tris-HCl buffer (pH8.0) containing 30 % glycerol 0.1M NaCl, 1mM DTT, 0.1mM PMSF.
Gene Name NT5C2 5'-nucleotidase, cytosolic II [ Homo sapiens (human) ]
Official Symbol NT5C2
Synonyms NT5C2; 5'-nucleotidase, cytosolic II; GMP; NT5B; PNT5; SPG45; SPG65; cN-II; cytosolic purine 5'-nucleotidase; 5'-nucleotidase (purine), cytosolic type B; IMP-specific 5'-NT; cytosolic IMP/GMP-specific 5'-nucleotidase; cytosolic nucleoside phosphotransferase 5'N; epididymis secretory sperm binding protein; high Km 5'-nucleotidase; spastic paraplegia 45 (autosomal recessive); EC 2.7.1.77; EC 3.1.3.5; EC 3.1.3.99
Gene ID 22978
mRNA Refseq NM_012229
Protein Refseq NP_036361
MIM 600417
UniProt ID P49902

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NT5C2 Products

Required fields are marked with *

My Review for All NT5C2 Products

Required fields are marked with *

0
cart-icon