Recombinant Human NT5C3 protein, GST-tagged
Cat.No. : | NT5C3-1382H |
Product Overview : | Recombinant Human NT5C3 protein(1-297 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-297 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NT5C3 5-nucleotidase, cytosolic III [ Homo sapiens ] |
Official Symbol | NT5C3 |
Synonyms | NT5C3; 5-nucleotidase, cytosolic III; cytosolic 5-nucleotidase 3; cN III; P5N 1; PN I; PSN1; UMPH; UMPH1; pyrimidine 5-nucleotidase 1; uridine 5-monophosphate hydrolase 1; p36; PN-I; P5N-1; cN-III; MGC27337; MGC87109; MGC87828; |
Gene ID | 51251 |
mRNA Refseq | NM_001002009 |
Protein Refseq | NP_001002009 |
MIM | 606224 |
UniProt ID | Q9H0P0 |
◆ Recombinant Proteins | ||
NT5C3-2931R | Recombinant Rhesus Macaque NT5C3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NT5C3-1382H | Recombinant Human NT5C3 protein, GST-tagged | +Inquiry |
Nt5c3-1079M | Recombinant Mouse Nt5c3 protein, His-tagged | +Inquiry |
Nt5c3-334M | Recombinant Mouse Nt5c3 Protein, MYC/DDK-tagged | +Inquiry |
NT5C3-10925M | Recombinant Mouse NT5C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C3-3676HCL | Recombinant Human NT5C3 293 Cell Lysate | +Inquiry |
NT5C3-3675HCL | Recombinant Human NT5C3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C3 Products
Required fields are marked with *
My Review for All NT5C3 Products
Required fields are marked with *
0
Inquiry Basket