Recombinant Human NT5C3 protein, GST-tagged

• Cat.No.: NT5C3-1382H
• Product Overview: Recombinant Human NT5C3 protein(1-297 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-297 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NT5C3 5-nucleotidase, cytosolic III [ Homo sapiens ]
• Official Symbol: NT5C3
• Synonyms: NT5C3; 5-nucleotidase, cytosolic III; cytosolic 5-nucleotidase 3; cN III; P5N 1; PN I; PSN1; UMPH; UMPH1; pyrimidine 5-nucleotidase 1; uridine 5-monophosphate hydrolase 1; p36; PN-I; P5N-1; cN-III; MGC27337; MGC87109; MGC87828
• Gene ID: 51251
• mRNA Refseq: NM_001002009
• Protein Refseq: NP_001002009
• MIM: 606224
• UniProt ID: Q9H0P0