Recombinant Human NTS protein, His-SUMO-tagged
Cat.No. : | NTS-3295H |
Product Overview : | Recombinant Human NTS protein(P30990)(24-143aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-143aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.7 kDa |
AA Sequence : | SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NTS neurotensin [ Homo sapiens ] |
Official Symbol | NTS |
Synonyms | NTS; neurotensin; neurotensin/neuromedin N; neuromedin N; NN; NT; NT/N; NTS1; NMN-125; |
Gene ID | 4922 |
mRNA Refseq | NM_006183 |
Protein Refseq | NP_006174 |
MIM | 162650 |
UniProt ID | P30990 |
◆ Recombinant Proteins | ||
NTS-3295H | Recombinant Human NTS protein, His-SUMO-tagged | +Inquiry |
NTS-8544H | Recombinant Human NTS protein, hFc-tagged | +Inquiry |
NTS-4776C | Recombinant Chicken NTS | +Inquiry |
NTS-4747H | Recombinant Human NTS Protein (Ser24-Leu148), His tagged | +Inquiry |
NTS-05C | Recombinant Cynomolgus NTS Protein, S24-L163, C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTS-3666HCL | Recombinant Human NTS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTS Products
Required fields are marked with *
My Review for All NTS Products
Required fields are marked with *
0
Inquiry Basket