Recombinant Human NUC Protein, His tagged, Biotin Labeled, Animal free
| Cat.No. : | NUC-0020 |
| Product Overview : | Recombinant Human Nucleosome protein (Biotin) is a Human Full Length protein, in the 2 to 136 aa range, expressed in Escherichia coli. Human recombinant nucleosomes consisting of 147 bp DNA (PCR) and 2 molecules each of histones H2A, H2B, H3 and H4. Each histone protein has an N-terminal His-tag. Each H2B has a C-terminal Cys added as a biotinylation site. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-36 aa |
| Conjugation/Label : | Biotin |
| Description : | Nucleosome is a fundamental unit of chromatin consisting of DNA wrapped around histone proteins. Alternate names include chromatin fibers and DNA-histone complexes. Each nucleosome contains an octamer of histones (two copies each of H2A H2B H3 and H4) with DNA coiled around it measuring about 11 nm in diameter. Nucleosomes are expressed in the nucleus of eukaryotic cells forming the basic structure of chromatin which further compacts to fit within the nucleus. |
| Form : | pH: 7.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.03% EDTA, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol |
| Molecular Mass : | 113.8 kDa |
| AASequence : | ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Purity : | >95%, suitable for SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Appropriate short-term storage conditions: -80 centigrade Appropriate long-term storage conditions: -80 centigrade Storage information: Avoid freeze / thaw cycle, Store in the dark |
| Shipping : | Dry Ice |
| Gene Name | H2BC21 H2B clustered histone 21 [ Homo sapiens (human) ] |
| Official Symbol | NUC |
| Synonyms | H2BC21; H2B clustered histone 21; H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; histone H2B type 2-E; H2B histone family, member Q; histone 2, H2be; histone H2B-GL105; histone H2B.q; histone cluster 2 H2B family member e; histone cluster 2, H2be |
| Gene ID | 8349 |
| mRNA Refseq | NM_003528 |
| Protein Refseq | NP_003519 |
| MIM | 601831 |
| UniProt ID | Q16778 |
| ◆ Native Proteins | ||
| NUC-0020 | Recombinant Human NUC Protein, His tagged, Biotin Labeled, Animal free | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUC Products
Required fields are marked with *
My Review for All NUC Products
Required fields are marked with *
Recently Viewed
