Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
82 |
Description : |
Nesfatin is a metabolic polypeptide and is the N-terminal region of the precursor protein, Nucleobindin2 (encoded by NUCB2 gene). It is a naturally occurring protein and originally identified as a hypothalamic neuropeptide. Additionally, Nesfatin can be found in other areas of brain, and in pancreatic islets β-cells, gastric endocrine cells and adipocytes. It is responsible for regulating appetite and production of body fat. Excess nesfatin-1 in the brain leads to a loss of appetite, less frequent hunger, a "sense of fullness", and a drop in body fat and weight. A lack of nesfatin-1 in the brain leads to an increase of appetite, more frequent episodes of hunger, an increase of body fat and weight, and the inability to "feel full". |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity is tested by in vivo assay using healthy wild type male mice (C57BL/6J). |
Molecular Mass : |
Approximately 9.6 kDa, a single non-glycosylated polypeptide chain containing 82 amino acids. |
AA Sequence : |
VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL |
Endotoxin : |
Less than 1 EU/µg of rHuNesfatin-1 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |