Recombinant Human NUCB2 protein
Cat.No. : | NUCB2-654H |
Product Overview : | Recombinant Human NUCB2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 82 |
Description : | Nesfatin is a metabolic polypeptide and is the N-terminal region of the precursor protein, Nucleobindin2 (encoded by NUCB2 gene). It is a naturally occurring protein and originally identified as a hypothalamic neuropeptide. Additionally, Nesfatin can be found in other areas of brain, and in pancreatic islets β-cells, gastric endocrine cells and adipocytes. It is responsible for regulating appetite and production of body fat. Excess nesfatin-1 in the brain leads to a loss of appetite, less frequent hunger, a "sense of fullness", and a drop in body fat and weight. A lack of nesfatin-1 in the brain leads to an increase of appetite, more frequent episodes of hunger, an increase of body fat and weight, and the inability to "feel full". |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity is tested by in vivo assay using healthy wild type male mice (C57BL/6J). |
Molecular Mass : | Approximately 9.6 kDa, a single non-glycosylated polypeptide chain containing 82 amino acids. |
AA Sequence : | VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL |
Endotoxin : | Less than 1 EU/µg of rHuNesfatin-1 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | NUCB2 |
Official Symbol | NUCB2 |
Synonyms | NUCB2; nucleobindin 2; nucleobindin-2; NEFA; nucleobinding 2; DNA-binding protein NEFA; gastric cancer antigen Zg4; |
Gene ID | 4925 |
mRNA Refseq | NM_005013 |
Protein Refseq | NP_005004 |
MIM | 608020 |
UniProt ID | P80303 |
◆ Recombinant Proteins | ||
NUCB2-3693H | Recombinant Human NUCB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nucb2-290R | Recombinant Rat Nucb2 Protein, His/GST-tagged | +Inquiry |
NUCB2-2169H | Recombinant Human Nucleobindin 2 | +Inquiry |
NUCB2-4749H | Recombinant Human NUCB2 Protein (Val25-Asp104), N-His tagged | +Inquiry |
NUCB2-3745H | Recombinant Human NUCB2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUCB2 Products
Required fields are marked with *
My Review for All NUCB2 Products
Required fields are marked with *
0
Inquiry Basket