Recombinant Human Nucleophosmin/nucleoplasmin 3, GST-tagged
Cat.No. : | NPM3-1418H |
Product Overview : | Recombinant full-length human NPM3( NP_008924.1, 1 a.a. - 178 a.a.) protein was expressed with a GST tag. MW = 45.650002 kDa(415 aa). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | GST |
Description : | Nucleoplasmin-3 is a protein that in humans is encoded by the NPM3 gene.The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. It is highly homologous to the murine Npm3 gene. Based on the structural similarity of the human NPM3 gene product to nucleoplasmin and nucleophosmin, NPM3 may represent a new member of this gene family, and may share basic functions with the molecular chaperones. |
Protein Sequence : | MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP |
Applications : | Enzyme-linked immunoabsorbent assay,Western Blot (Recombinant protein),Antibody Production,Protein Array. |
Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage : | Store at -80°C.Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein. |
Gene Name | NPM3 nucleophosmin/nucleoplasmin 3 [ Homo sapiens ] |
Synonyms | NPM3; nucleophosmin/nucleoplasmin 3; nucleoplasmin-3; nucleophosmin/nucleoplasmin family, member 3; OTTHUMP00000020352; PORMIN; TMEM123 |
Gene ID | 10360 |
mRNA Refseq | NM_006993 |
Protein Refseq | NP_008924 |
MIM | 606456 |
UniProt ID | O75607 |
Chromosome Location | 10q24.31 |
Function | nucleic acid binding IEA; protein binding |
◆ Recombinant Proteins | ||
NPM3-1552H | Recombinant Human NPM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPM3-1418H | Recombinant Human Nucleophosmin/nucleoplasmin 3, GST-tagged | +Inquiry |
NPM3-6640HF | Recombinant Full Length Human NPM3 Protein, GST-tagged | +Inquiry |
NPM3-6039H | Recombinant Human NPM3 Protein, GST-tagged | +Inquiry |
NPM3-6166M | Recombinant Mouse NPM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM3-3736HCL | Recombinant Human NPM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPM3 Products
Required fields are marked with *
My Review for All NPM3 Products
Required fields are marked with *
0
Inquiry Basket