Recombinant Human Nucleophosmin/nucleoplasmin 3, GST-tagged

Cat.No. : NPM3-1418H
Product Overview : Recombinant full-length human NPM3( NP_008924.1, 1 a.a. - 178 a.a.) protein was expressed with a GST tag. MW = 45.650002 kDa(415 aa).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : GST
Description : Nucleoplasmin-3 is a protein that in humans is encoded by the NPM3 gene.The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. It is highly homologous to the murine Npm3 gene. Based on the structural similarity of the human NPM3 gene product to nucleoplasmin and nucleophosmin, NPM3 may represent a new member of this gene family, and may share basic functions with the molecular chaperones.
Protein Sequence : MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
Applications : Enzyme-linked immunoabsorbent assay,Western Blot (Recombinant protein),Antibody Production,Protein Array.
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage : Store at -80°C.Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Gene Name NPM3 nucleophosmin/nucleoplasmin 3 [ Homo sapiens ]
Synonyms NPM3; nucleophosmin/nucleoplasmin 3; nucleoplasmin-3; nucleophosmin/nucleoplasmin family, member 3; OTTHUMP00000020352; PORMIN; TMEM123
Gene ID 10360
mRNA Refseq NM_006993
Protein Refseq NP_008924
MIM 606456
UniProt ID O75607
Chromosome Location 10q24.31
Function nucleic acid binding IEA; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPM3 Products

Required fields are marked with *

My Review for All NPM3 Products

Required fields are marked with *

0
cart-icon
0
compare icon