Recombinant Human NUDT1 protein

• Cat.No.: NUDT1-3296H
• Product Overview: Recombinant Human NUDT1 protein(P36639)(19-197aa) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 19-197aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.3 kDa
• AA Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NUDT1 nudix (nucleoside diphosphate linked moiety X)-type motif 1 [ Homo sapiens ]
• Official Symbol: NUDT1
• Synonyms: NUDT1; nudix (nucleoside diphosphate linked moiety X)-type motif 1; MTH1; 7,8-dihydro-8-oxoguanine triphosphatase; 7; 8 dihydro 8 oxoguanine triphosphatase; 8 oxo 7; 8 dihydrodeoxyguanosine triphosphatase; 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; mutT human homolog 1; nucleoside diphosphate linked moiety X type motif 1; nudix motif 1; 8-oxo-dGTPase; 2-hydroxy-dATP diphosphatase; 8-oxo-7,8-dihydroguanosine triphosphatase; 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase; nucleoside diphosphate-linked moiety X motif 1; nucleoside diphosphate-linked moiety X-type motif 1
• Gene ID: 4521
• mRNA Refseq: NM_002452
• Protein Refseq: NP_002443
• MIM: 600312
• UniProt ID: P36639