Recombinant Human NUDT2 protein, GST-tagged

• Cat.No.: NUDT2-3664H
• Product Overview: Recombinant Human NUDT2 protein(1-147 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-147 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NUDT2 nudix (nucleoside diphosphate linked moiety X)-type motif 2 [ Homo sapiens ]
• Official Symbol: NUDT2
• Synonyms: NUDT2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; APAH1; bis(5-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4A hydrolase 1; Ap4Aase; bis(5 nucleosyl) tetraphosphatase (asymmetrical); diadenosine 5; 5 P1; P4 tetraphosphate pyrophosphohydrolase; diadenosine tetraphosphatase; nudix motif 2; nucleoside diphosphate-linked moiety X motif 2; bis(5-nucleosyl)-tetraphosphatase (asymmetrical); diadenosine 5,5-P1,P4-tetraphosphate pyrophosphohydrolase; diadenosine 5,5-P1,P4-tetraphosphate asymmetrical hydrolase; MGC10404
• Gene ID: 318
• mRNA Refseq: NM_001161
• Protein Refseq: NP_001152
• MIM: 602852
• UniProt ID: P50583