Recombinant Human NUDT2 protein, GST-tagged
Cat.No. : | NUDT2-3664H |
Product Overview : | Recombinant Human NUDT2 protein(P50583)(1-147aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-147aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.8 kDa |
AA Sequence : | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NUDT2 nudix (nucleoside diphosphate linked moiety X)-type motif 2 [ Homo sapiens ] |
Official Symbol | NUDT2 |
Synonyms | NUDT2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; APAH1; bis(5-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4A hydrolase 1; Ap4Aase; bis(5 nucleosyl) tetraphosphatase (asymmetrical); diadenosine 5; 5 P1; P4 tetraphosphate pyrophosphohydrolase; diadenosine tetraphosphatase; nudix motif 2; nucleoside diphosphate-linked moiety X motif 2; bis(5-nucleosyl)-tetraphosphatase (asymmetrical); diadenosine 5,5-P1,P4-tetraphosphate pyrophosphohydrolase; diadenosine 5,5-P1,P4-tetraphosphate asymmetrical hydrolase; MGC10404; |
Gene ID | 318 |
mRNA Refseq | NM_001161 |
Protein Refseq | NP_001152 |
MIM | 602852 |
UniProt ID | P50583 |
◆ Recombinant Proteins | ||
Nudt2-4539M | Recombinant Mouse Nudt2 Protein, Myc/DDK-tagged | +Inquiry |
NUDT2-6255M | Recombinant Mouse NUDT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT2-29730TH | Recombinant Human NUDT2 | +Inquiry |
NUDT2-3664H | Recombinant Human NUDT2 protein, GST-tagged | +Inquiry |
NUDT2-472Z | Recombinant Zebrafish NUDT2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT2-3648HCL | Recombinant Human NUDT2 293 Cell Lysate | +Inquiry |
NUDT2-3647HCL | Recombinant Human NUDT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT2 Products
Required fields are marked with *
My Review for All NUDT2 Products
Required fields are marked with *