Recombinant Human NUDT2 protein, GST-tagged

Cat.No. : NUDT2-3664H
Product Overview : Recombinant Human NUDT2 protein(P50583)(1-147aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-147aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.8 kDa
AA Sequence : MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NUDT2 nudix (nucleoside diphosphate linked moiety X)-type motif 2 [ Homo sapiens ]
Official Symbol NUDT2
Synonyms NUDT2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; APAH1; bis(5-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4A hydrolase 1; Ap4Aase; bis(5 nucleosyl) tetraphosphatase (asymmetrical); diadenosine 5; 5 P1; P4 tetraphosphate pyrophosphohydrolase; diadenosine tetraphosphatase; nudix motif 2; nucleoside diphosphate-linked moiety X motif 2; bis(5-nucleosyl)-tetraphosphatase (asymmetrical); diadenosine 5,5-P1,P4-tetraphosphate pyrophosphohydrolase; diadenosine 5,5-P1,P4-tetraphosphate asymmetrical hydrolase; MGC10404;
Gene ID 318
mRNA Refseq NM_001161
Protein Refseq NP_001152
MIM 602852
UniProt ID P50583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT2 Products

Required fields are marked with *

My Review for All NUDT2 Products

Required fields are marked with *

0
cart-icon