Recombinant Human NUDT3 protein, GST-tagged
| Cat.No. : | NUDT3-30117H |
| Product Overview : | Recombinant Human NUDT3 (1-172 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Arg172 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NUDT3 nudix (nucleoside diphosphate linked moiety X)-type motif 3 [ Homo sapiens ] |
| Official Symbol | NUDT3 |
| Synonyms | NUDT3; nudix (nucleoside diphosphate linked moiety X)-type motif 3; diphosphoinositol polyphosphate phosphohydrolase 1; DIPP; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 1; DIPP1; DIPP-1; |
| Gene ID | 11165 |
| mRNA Refseq | NM_006703 |
| Protein Refseq | NP_006694 |
| MIM | 609228 |
| UniProt ID | O95989 |
| ◆ Recombinant Proteins | ||
| NUDT3-27534TH | Recombinant Human NUDT3, His-tagged | +Inquiry |
| NUDT3-4118R | Recombinant Rat NUDT3 Protein | +Inquiry |
| NUDT3-3476H | Recombinant Human NUDT3, His-tagged | +Inquiry |
| NUDT3-376H | Recombinant Human NUDT3 protein, His-tagged | +Inquiry |
| Nudt3-4541M | Recombinant Mouse Nudt3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUDT3-1227HCL | Recombinant Human NUDT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT3 Products
Required fields are marked with *
My Review for All NUDT3 Products
Required fields are marked with *
