Recombinant Human NUDT3 protein, GST-tagged
Cat.No. : | NUDT3-30117H |
Product Overview : | Recombinant Human NUDT3 (1-172 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Arg172 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NUDT3 nudix (nucleoside diphosphate linked moiety X)-type motif 3 [ Homo sapiens ] |
Official Symbol | NUDT3 |
Synonyms | NUDT3; nudix (nucleoside diphosphate linked moiety X)-type motif 3; diphosphoinositol polyphosphate phosphohydrolase 1; DIPP; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 1; DIPP1; DIPP-1; |
Gene ID | 11165 |
mRNA Refseq | NM_006703 |
Protein Refseq | NP_006694 |
MIM | 609228 |
UniProt ID | O95989 |
◆ Recombinant Proteins | ||
NUDT3-1406H | Recombinant Human NUDT3, GST-tagged | +Inquiry |
NUDT3-2946R | Recombinant Rhesus Macaque NUDT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT3-30117H | Recombinant Human NUDT3 protein, GST-tagged | +Inquiry |
NUDT3-3128R | Recombinant Rhesus monkey NUDT3 Protein, His-tagged | +Inquiry |
NUDT3-6258M | Recombinant Mouse NUDT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT3-1227HCL | Recombinant Human NUDT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUDT3 Products
Required fields are marked with *
My Review for All NUDT3 Products
Required fields are marked with *
0
Inquiry Basket