Recombinant Human NUDT3 protein, His-tagged

Cat.No. : NUDT3-376H
Product Overview : Recombinant Human NUDT3 protein(NP_006694)(1-172 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-172 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NUDT3 nudix (nucleoside diphosphate linked moiety X)-type motif 3 [ Homo sapiens ]
Official Symbol NUDT3
Synonyms NUDT3; nudix (nucleoside diphosphate linked moiety X)-type motif 3; diphosphoinositol polyphosphate phosphohydrolase 1; DIPP; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 1; DIPP1; DIPP-1;
Gene ID 11165
mRNA Refseq NM_006703
Protein Refseq NP_006694
MIM 609228
UniProt ID O95989

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT3 Products

Required fields are marked with *

My Review for All NUDT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon