Recombinant Human NUDT3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NUDT3-3144H |
Product Overview : | NUDT3 MS Standard C13 and N15-labeled recombinant protein (NP_006694) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions. |
Molecular Mass : | 19.3 kDa |
AA Sequence : | MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NUDT3 nudix hydrolase 3 [ Homo sapiens (human) ] |
Official Symbol | NUDT3 |
Synonyms | NUDT3; nudix (nucleoside diphosphate linked moiety X)-type motif 3; diphosphoinositol polyphosphate phosphohydrolase 1; DIPP; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 1; DIPP1; DIPP-1; |
Gene ID | 11165 |
mRNA Refseq | NM_006703 |
Protein Refseq | NP_006694 |
MIM | 609228 |
UniProt ID | O95989 |
◆ Recombinant Proteins | ||
NUDT3-376H | Recombinant Human NUDT3 protein, His-tagged | +Inquiry |
NUDT3-3779R | Recombinant Rat NUDT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT3-3144H | Recombinant Human NUDT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDT3-2946R | Recombinant Rhesus Macaque NUDT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT3-27534TH | Recombinant Human NUDT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT3-1227HCL | Recombinant Human NUDT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT3 Products
Required fields are marked with *
My Review for All NUDT3 Products
Required fields are marked with *
0
Inquiry Basket