Recombinant Human NUDT4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NUDT4-2144H
Product Overview : NUDT4 MS Standard C13 and N15-labeled recombinant protein (NP_061967) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing.
Molecular Mass : 20.4 kDa
AA Sequence : MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NUDT4 nudix hydrolase 4 [ Homo sapiens (human) ]
Official Symbol NUDT4
Synonyms NUDT4; nudix (nucleoside diphosphate linked moiety X)-type motif 4; diphosphoinositol polyphosphate phosphohydrolase 2; diphosphoinositol polyphosphate phosphohydrolase type 2; DIPP2; DIPP2alpha; DIPP2beta; HDCMB47P; KIAA0487; DIPP-2; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 2; DKFZp686I1281;
Gene ID 11163
mRNA Refseq NM_019094
Protein Refseq NP_061967
MIM 609229
UniProt ID Q9NZJ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT4 Products

Required fields are marked with *

My Review for All NUDT4 Products

Required fields are marked with *

0
cart-icon