Recombinant Human NUDT4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NUDT4-2144H |
| Product Overview : | NUDT4 MS Standard C13 and N15-labeled recombinant protein (NP_061967) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. |
| Molecular Mass : | 20.4 kDa |
| AA Sequence : | MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NUDT4 nudix hydrolase 4 [ Homo sapiens (human) ] |
| Official Symbol | NUDT4 |
| Synonyms | NUDT4; nudix (nucleoside diphosphate linked moiety X)-type motif 4; diphosphoinositol polyphosphate phosphohydrolase 2; diphosphoinositol polyphosphate phosphohydrolase type 2; DIPP2; DIPP2alpha; DIPP2beta; HDCMB47P; KIAA0487; DIPP-2; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 2; DKFZp686I1281; |
| Gene ID | 11163 |
| mRNA Refseq | NM_019094 |
| Protein Refseq | NP_061967 |
| MIM | 609229 |
| UniProt ID | Q9NZJ9 |
| ◆ Recombinant Proteins | ||
| NUDT4-3129R | Recombinant Rhesus monkey NUDT4 Protein, His-tagged | +Inquiry |
| NUDT4-4119R | Recombinant Rat NUDT4 Protein | +Inquiry |
| NUDT4-2947R | Recombinant Rhesus Macaque NUDT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUDT4-585H | Recombinant Human nudix (nucleoside diphosphate linked moiety X)-type motif 4, His-tagged | +Inquiry |
| NUDT4-3780R | Recombinant Rat NUDT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUDT4-3644HCL | Recombinant Human NUDT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT4 Products
Required fields are marked with *
My Review for All NUDT4 Products
Required fields are marked with *
