Recombinant Human NUF2, His-tagged

Cat.No. : NUF2-30416TH
Product Overview : Recombinant fragment, corresponding to amino acids 316-464 of Human Nuf2 with N terminal His tag; Predicted MWt 18 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 316-464 a.a.
Description : This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 99 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATA QFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTT INQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALE KYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST
Sequence Similarities : Belongs to the NUF2 family.
Gene Name NUF2 NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol NUF2
Synonyms NUF2; NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae); CDCA1, cell division cycle associated 1; kinetochore protein Nuf2; cancer/testis antigen 106; CT106; NUF2R;
Gene ID 83540
mRNA Refseq NM_031423
Protein Refseq NP_113611
MIM 611772
Uniprot ID Q9BZD4
Chromosome Location 1q23.3
Pathway Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem;
Function molecular_function; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUF2 Products

Required fields are marked with *

My Review for All NUF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon