Recombinant Human NUF2, His-tagged
| Cat.No. : | NUF2-30416TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 316-464 of Human Nuf2 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 316-464 a.a. |
| Description : | This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 99 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATA QFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTT INQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALE KYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST |
| Sequence Similarities : | Belongs to the NUF2 family. |
| Gene Name | NUF2 NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | NUF2 |
| Synonyms | NUF2; NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae); CDCA1, cell division cycle associated 1; kinetochore protein Nuf2; cancer/testis antigen 106; CT106; NUF2R; |
| Gene ID | 83540 |
| mRNA Refseq | NM_031423 |
| Protein Refseq | NP_113611 |
| MIM | 611772 |
| Uniprot ID | Q9BZD4 |
| Chromosome Location | 1q23.3 |
| Pathway | Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem; |
| Function | molecular_function; protein binding; |
| ◆ Recombinant Proteins | ||
| NUF2-4123R | Recombinant Rat NUF2 Protein | +Inquiry |
| NUF2-2951R | Recombinant Rhesus Macaque NUF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUF2-02HFL | Recombinant Full Length Human NUF2 Protein, His tagged | +Inquiry |
| NUF2-6264M | Recombinant Mouse NUF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUF2-30416TH | Recombinant Human NUF2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUF2-3638HCL | Recombinant Human NUF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUF2 Products
Required fields are marked with *
My Review for All NUF2 Products
Required fields are marked with *



