Recombinant Human NUF2, His-tagged
Cat.No. : | NUF2-30416TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 316-464 of Human Nuf2 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 316-464 a.a. |
Description : | This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 99 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATA QFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTT INQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALE KYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST |
Sequence Similarities : | Belongs to the NUF2 family. |
Gene Name | NUF2 NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NUF2 |
Synonyms | NUF2; NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae); CDCA1, cell division cycle associated 1; kinetochore protein Nuf2; cancer/testis antigen 106; CT106; NUF2R; |
Gene ID | 83540 |
mRNA Refseq | NM_031423 |
Protein Refseq | NP_113611 |
MIM | 611772 |
Uniprot ID | Q9BZD4 |
Chromosome Location | 1q23.3 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem; |
Function | molecular_function; protein binding; |
◆ Recombinant Proteins | ||
NUF2-6048C | Recombinant Chicken NUF2 | +Inquiry |
NUF2-3392HF | Recombinant Full Length Human NUF2 Protein, GST-tagged | +Inquiry |
NUF2-10639Z | Recombinant Zebrafish NUF2 | +Inquiry |
NUF2-1320H | Recombinant Human NUF2 Protein, GST-Tagged | +Inquiry |
NUF2-4123R | Recombinant Rat NUF2 Protein | +Inquiry |
◆ Native Proteins | ||
NUF2-02HFL | Recombinant Full Length Human NUF2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUF2-3638HCL | Recombinant Human NUF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUF2 Products
Required fields are marked with *
My Review for All NUF2 Products
Required fields are marked with *