Recombinant Human NUFIP2 protein(1-350 aa), GST-tagged
| Cat.No. : | NUFIP2-95H |
| Product Overview : | Recombinant Human NUFIP2 protein(1-350 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MEEKPGQPQPQHHHSHHHPHHHPQQQQQQPHHHHHYYFYNHSHNHHHHHHHQQPHQYLQHGAEGSPKAQPKPLKHEQKHTLQQHQETPKKKTGYGELNGNAGEREISLKNLSSDEATNPISRVLNGNQQVVDTSLKQTVKANTFGKAGIKTKNFIQKNSMDKKNGKSYENKSGENQSVDKSDTIPIPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETGPGGTSRGKPAVGDMLRKSSDSKPGVSSKKFDDRPKGKHASAVASKEDSWTLFKPPPVFPVDNSSA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | NUFIP2 nuclear fragile X mental retardation protein interacting protein 2 [ Homo sapiens ] |
| Official Symbol | NUFIP2 |
| Synonyms | 182-FIP; 82-FIP; FIP-82; FLJ10976; KIAA1321; MGC117262; PIG1; NUFIP2 |
| Gene ID | 57532 |
| mRNA Refseq | NM_020772 |
| Protein Refseq | NP_065823 |
| MIM | 609356 |
| UniProt ID | A1L3A7 |
| ◆ Recombinant Proteins | ||
| NUFIP2-10983M | Recombinant Mouse NUFIP2 Protein | +Inquiry |
| NUFIP2-3699H | Recombinant Human NUFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUFIP2-53HCL | Recombinant Human NUFIP2 Over-expression Lysate, C-Myc/DDK tagged | +Inquiry |
| NUFIP2-2952R | Recombinant Rhesus Macaque NUFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUFIP2-931H | Recombinant Human NUFIP2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUFIP2-3637HCL | Recombinant Human NUFIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUFIP2 Products
Required fields are marked with *
My Review for All NUFIP2 Products
Required fields are marked with *
