Recombinant Human NUFIP2 protein(1-350 aa), GST-tagged

Cat.No. : NUFIP2-95H
Product Overview : Recombinant Human NUFIP2 protein(1-350 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-350 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MEEKPGQPQPQHHHSHHHPHHHPQQQQQQPHHHHHYYFYNHSHNHHHHHHHQQPHQYLQHGAEGSPKAQPKPLKHEQKHTLQQHQETPKKKTGYGELNGNAGEREISLKNLSSDEATNPISRVLNGNQQVVDTSLKQTVKANTFGKAGIKTKNFIQKNSMDKKNGKSYENKSGENQSVDKSDTIPIPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETGPGGTSRGKPAVGDMLRKSSDSKPGVSSKKFDDRPKGKHASAVASKEDSWTLFKPPPVFPVDNSSA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name NUFIP2 nuclear fragile X mental retardation protein interacting protein 2 [ Homo sapiens ]
Official Symbol NUFIP2
Synonyms 182-FIP; 82-FIP; FIP-82; FLJ10976; KIAA1321; MGC117262; PIG1; NUFIP2
Gene ID 57532
mRNA Refseq NM_020772
Protein Refseq NP_065823
MIM 609356
UniProt ID A1L3A7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUFIP2 Products

Required fields are marked with *

My Review for All NUFIP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon