Recombinant Human NUMB endocytic adaptor protein Protein, His-tagged

Cat.No. : NUMB-01H
Product Overview : Recombinant Human NUMB Protein with His tag was expressed in E. coli.
Availability July 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 356-592 aa
Description : The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.
Molecular Mass : 26.3 kDa
AA Sequence : MTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIELHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose
Concentration : 0.8 mg/mL by BCA
Gene Name NUMB NUMB endocytic adaptor protein [ Homo sapiens (human) ]
Official Symbol NUMB
Synonyms NUMB; numb homolog (Drosophila); C14orf41, chromosome 14 open reading frame 41 , numb (Drosophila) homolog; protein numb homolog; h-Numb; S171; C14orf41; c14_5527; FLJ31314;
Gene ID 8650
mRNA Refseq NM_001005743
Protein Refseq NP_001005743
MIM 603728
UniProt ID P49757

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUMB Products

Required fields are marked with *

My Review for All NUMB Products

Required fields are marked with *

0
cart-icon