Recombinant Human NUMB endocytic adaptor protein Protein, His-tagged
| Cat.No. : | NUMB-01H |
| Product Overview : | Recombinant Human NUMB Protein with His tag was expressed in E. coli. |
| Availability | August 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 356-592 aa |
| Description : | The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 26.3 kDa |
| AA Sequence : | MTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIELHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose |
| Concentration : | 0.8 mg/mL by BCA |
| Gene Name | NUMB NUMB endocytic adaptor protein [ Homo sapiens (human) ] |
| Official Symbol | NUMB |
| Synonyms | NUMB; numb homolog (Drosophila); C14orf41, chromosome 14 open reading frame 41 , numb (Drosophila) homolog; protein numb homolog; h-Numb; S171; C14orf41; c14_5527; FLJ31314; |
| Gene ID | 8650 |
| mRNA Refseq | NM_001005743 |
| Protein Refseq | NP_001005743 |
| MIM | 603728 |
| UniProt ID | P49757 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUMB Products
Required fields are marked with *
My Review for All NUMB Products
Required fields are marked with *



