Recombinant Human NUMB endocytic adaptor protein Protein, His-tagged
Cat.No. : | NUMB-01H |
Product Overview : | Recombinant Human NUMB Protein with His tag was expressed in E. coli. |
Availability | September 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 356-592 aa |
Description : | The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | MTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIELHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose |
Concentration : | 0.8 mg/mL by BCA |
Gene Name | NUMB NUMB endocytic adaptor protein [ Homo sapiens (human) ] |
Official Symbol | NUMB |
Synonyms | NUMB; numb homolog (Drosophila); C14orf41, chromosome 14 open reading frame 41 , numb (Drosophila) homolog; protein numb homolog; h-Numb; S171; C14orf41; c14_5527; FLJ31314; |
Gene ID | 8650 |
mRNA Refseq | NM_001005743 |
Protein Refseq | NP_001005743 |
MIM | 603728 |
UniProt ID | P49757 |
◆ Recombinant Proteins | ||
NUMB-6267M | Recombinant Mouse NUMB Protein, His (Fc)-Avi-tagged | +Inquiry |
NUMB-5232H | Recombinant Human NUMB Protein (Leu376-Phe482), N-His tagged | +Inquiry |
NUMB-237H | Recombinant Human NUMB protein, His-tagged | +Inquiry |
Numb-4547M | Recombinant Mouse Numb Protein, Myc/DDK-tagged | +Inquiry |
NUMB-911HFL | Recombinant Full Length Human NUMB Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUMB-3636HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
NUMB-3634HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
NUMB-3635HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUMB Products
Required fields are marked with *
My Review for All NUMB Products
Required fields are marked with *