Recombinant Human NUMB endocytic adaptor protein Protein, His-tagged

• Cat.No.: NUMB-01H
• Product Overview: Recombinant Human NUMB Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 356-592 aa
• Description: The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 26.3 kDa
• AA Sequence: MTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIELHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose
• Concentration: 0.8 mg/mL by BCA

Gene Information

• Gene Name: NUMB NUMB endocytic adaptor protein [ Homo sapiens (human) ]
• Official Symbol: NUMB
• Synonyms: NUMB; numb homolog (Drosophila); C14orf41, chromosome 14 open reading frame 41 , numb (Drosophila) homolog; protein numb homolog; h-Numb; S171; C14orf41; c14_5527; FLJ31314
• Gene ID: 8650
• mRNA Refseq: NM_001005743
• Protein Refseq: NP_001005743
• MIM: 603728
• UniProt ID: P49757