Recombinant Human NUP210 Protein (1529-1808 aa), His-tagged
Cat.No. : | NUP210-696H |
Product Overview : | Recombinant Human NUP210 Protein (1529-1808 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1529-1808 aa |
Description : | Nucleoporin essential for nuclear pore assbly and fusion, nuclear pore spacing, as well as structural integrity. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 34.5 kDa |
AA Sequence : | AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NUP210 nucleoporin 210kDa [ Homo sapiens ] |
Official Symbol | NUP210 |
Synonyms | NUP210; FLJ22389; GP210; KIAA0906; POM210; |
Gene ID | 23225 |
mRNA Refseq | NM_024923 |
Protein Refseq | NP_079199 |
MIM | 607703 |
UniProt ID | Q8TEM1 |
◆ Recombinant Proteins | ||
NUP210-697H | Recombinant Human NUP210 Protein (28-238 aa), His-tagged | +Inquiry |
NUP210-3787R | Recombinant Rat NUP210 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUP210-4137H | Recombinant Human NUP210 Protein (Leu1288-Val1449), N-His tagged | +Inquiry |
NUP210-5495H | Recombinant Human NUP210 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUP210-6935H | Recombinant Human NUP210 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUP210 Products
Required fields are marked with *
My Review for All NUP210 Products
Required fields are marked with *