Recombinant Human NUP210 Protein (1529-1808 aa), His-tagged
| Cat.No. : | NUP210-696H |
| Product Overview : | Recombinant Human NUP210 Protein (1529-1808 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1529-1808 aa |
| Description : | Nucleoporin essential for nuclear pore assbly and fusion, nuclear pore spacing, as well as structural integrity. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 34.5 kDa |
| AA Sequence : | AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | NUP210 nucleoporin 210kDa [ Homo sapiens ] |
| Official Symbol | NUP210 |
| Synonyms | NUP210; FLJ22389; GP210; KIAA0906; POM210; |
| Gene ID | 23225 |
| mRNA Refseq | NM_024923 |
| Protein Refseq | NP_079199 |
| MIM | 607703 |
| UniProt ID | Q8TEM1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUP210 Products
Required fields are marked with *
My Review for All NUP210 Products
Required fields are marked with *



