"NUP62" Related Products

Expand
Expand

Recombinant Human NUP62 protein, T7-tagged

Cat.No.: NUP62-147H
Product Overview: Recombinant human NUP62 (522aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFGSTSMSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPS TGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTS SQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPA APTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATT TSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQAT QVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEERE KTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVC EGRRKEQERSFRITFD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro NUP62 mediated cytoplasmic protein nuclei transportation regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NUP62 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: NUP62 nucleoporin 62kDa [ Homo sapiens ]
Official Symbol: NUP62
Synonyms: NUP62; nucleoporin 62kDa; nucleoporin 62kD; nuclear pore glycoprotein p62; DKFZp547L134; FLJ20822; FLJ43869; IBSN; MGC841; p62; SNDI; nucleoporin Nup62; 62 kDa nucleoporin;
Gene ID: 23636
mRNA Refseq: NM_001193357
Protein Refseq: NP_001180286
MIM: 605815
UniProt ID: P37198
Chromosome Location: 19
Pathway: Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Disease, organism-specific biosystem; Export of Viral Ribonucleoproteins from Nucleus, organism-specific biosystem; Gene Expression, organism-specific biosystem; Glucose transport, organism-specific biosystem; HIV Infection, organism-specific biosystem;
Function: PTB domain binding; SH2 domain binding; SH2 domain binding; chromatin binding; contributes_to nucleocytoplasmic transporter activity; protein binding; receptor signaling complex scaffold activity; receptor signaling complex scaffold activity; structural c

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.