Recombinant Human NUP62 protein, T7-tagged

Cat.No. : NUP62-147H
Product Overview : Recombinant human NUP62 (522aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 522 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSTSMSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPS TGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTS SQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPA APTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATT TSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQAT QVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEERE KTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVC EGRRKEQERSFRITFD
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro NUP62 mediated cytoplasmic protein nuclei transportation regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NUP62 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name NUP62 nucleoporin 62kDa [ Homo sapiens ]
Official Symbol NUP62
Synonyms NUP62; nucleoporin 62kDa; nucleoporin 62kD; nuclear pore glycoprotein p62; DKFZp547L134; FLJ20822; FLJ43869; IBSN; MGC841; p62; SNDI; nucleoporin Nup62; 62 kDa nucleoporin;
Gene ID 23636
mRNA Refseq NM_001193357
Protein Refseq NP_001180286
MIM 605815
UniProt ID P37198
Chromosome Location 19
Pathway Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Disease, organism-specific biosystem; Export of Viral Ribonucleoproteins from Nucleus, organism-specific biosystem; Gene Expression, organism-specific biosystem; Glucose transport, organism-specific biosystem; HIV Infection, organism-specific biosystem;
Function PTB domain binding; SH2 domain binding; SH2 domain binding; chromatin binding; contributes_to nucleocytoplasmic transporter activity; protein binding; receptor signaling complex scaffold activity; receptor signaling complex scaffold activity; structural c

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUP62 Products

Required fields are marked with *

My Review for All NUP62 Products

Required fields are marked with *

0
cart-icon