Recombinant Human NUP62 protein, T7-tagged
Cat.No. : | NUP62-147H |
Product Overview : | Recombinant human NUP62 (522aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 522 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSTSMSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPS TGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTS SQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPA APTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATT TSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQAT QVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEERE KTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVC EGRRKEQERSFRITFD |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro NUP62 mediated cytoplasmic protein nuclei transportation regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NUP62 protein-protein interaction.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NUP62 nucleoporin 62kDa [ Homo sapiens ] |
Official Symbol | NUP62 |
Synonyms | NUP62; nucleoporin 62kDa; nucleoporin 62kD; nuclear pore glycoprotein p62; DKFZp547L134; FLJ20822; FLJ43869; IBSN; MGC841; p62; SNDI; nucleoporin Nup62; 62 kDa nucleoporin; |
Gene ID | 23636 |
mRNA Refseq | NM_001193357 |
Protein Refseq | NP_001180286 |
MIM | 605815 |
UniProt ID | P37198 |
Chromosome Location | 19 |
Pathway | Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Disease, organism-specific biosystem; Export of Viral Ribonucleoproteins from Nucleus, organism-specific biosystem; Gene Expression, organism-specific biosystem; Glucose transport, organism-specific biosystem; HIV Infection, organism-specific biosystem; |
Function | PTB domain binding; SH2 domain binding; SH2 domain binding; chromatin binding; contributes_to nucleocytoplasmic transporter activity; protein binding; receptor signaling complex scaffold activity; receptor signaling complex scaffold activity; structural c |
◆ Recombinant Proteins | ||
NUP62-843H | Recombinant Human NUP62, His-tagged | +Inquiry |
NUP62-2956H | Recombinant Human NUP62, T7-tagged | +Inquiry |
NUP62-845H | Recombinant Human NUP62, MYC/DDK-tagged | +Inquiry |
NUP62-459H | Recombinant Human NUP62 Protein, His-tagged | +Inquiry |
NUP62-844H | Recombinant Human NUP62, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUP62-1233HCL | Recombinant Human NUP62 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUP62 Products
Required fields are marked with *
My Review for All NUP62 Products
Required fields are marked with *