Recombinant Human NUTF2 protein, GST-tagged
| Cat.No. : | NUTF2-3298H |
| Product Overview : | Recombinant Human NUTF2 protein(P61970)(1-127aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-127aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.5 kDa |
| AA Sequence : | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | NUTF2 nuclear transport factor 2 [ Homo sapiens ] |
| Official Symbol | NUTF2 |
| Synonyms | NUTF2; nuclear transport factor 2; NTF2; PP15; NTF-2; placental protein 15; |
| Gene ID | 10204 |
| mRNA Refseq | NM_005796 |
| Protein Refseq | NP_005787 |
| MIM | 605813 |
| UniProt ID | P61970 |
| ◆ Recombinant Proteins | ||
| NUTF2-2276C | Recombinant Chicken NUTF2 | +Inquiry |
| NUTF2-1520Z | Recombinant Zebrafish NUTF2 | +Inquiry |
| NUTF2-1425H | Recombinant Human NUTF2, GST-tagged | +Inquiry |
| Nutf2-4560M | Recombinant Mouse Nutf2 Protein, Myc/DDK-tagged | +Inquiry |
| NUTF2-1566H | Recombinant Human NUTF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUTF2-448HCL | Recombinant Human NUTF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUTF2 Products
Required fields are marked with *
My Review for All NUTF2 Products
Required fields are marked with *
