Recombinant Human NVL, His-tagged

Cat.No. : NVL-30495TH
Product Overview : Recombinant fragment, corresponding to amino acids 431-734 of Human NVL with an N terminal His tag. Predicted mwt: 34 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 431-734 a.a.
Description : This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. Two encoded proteins, described as major and minor isoforms, have been localized to distinct regions of the nucleus. The largest encoded protein (major isoform) has been localized to the nucleolus and shown to participate in ribosome biosynthesis (PMID: 15469983, 16782053), while the minor isoform has been localized to the nucleoplasmin.
Conjugation : HIS
Tissue specificity : Widely expressed. Highest level of expression in heart, placenta, skeletal muscle, pancreas and retina.
Form : Lyophilised:Reconstitute with 60 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVP NVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVT PAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSD RETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDII DPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPL DADVNLEAIAGDLRCDCYTGADLSALVREASICALRQE MARQKSGNEKGELKVSHKHFEEAFKKVRSSIS
Sequence Similarities : Belongs to the AAA ATPase family.
Gene Name NVL nuclear VCP-like [ Homo sapiens ]
Official Symbol NVL
Synonyms NVL; nuclear VCP-like; nuclear valosin-containing protein-like; Nuclear valosin containing protein like; nuclear VCP like protein;
Gene ID 4931
mRNA Refseq NM_001243146
Protein Refseq NP_001230075
MIM 602426
Uniprot ID O15381
Chromosome Location 1q41-q42.2
Pathway Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function ATP binding; nucleoside-triphosphatase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NVL Products

Required fields are marked with *

My Review for All NVL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon