Recombinant Human NVL, His-tagged
Cat.No. : | NVL-30495TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 431-734 of Human NVL with an N terminal His tag. Predicted mwt: 34 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 431-734 a.a. |
Description : | This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. Two encoded proteins, described as major and minor isoforms, have been localized to distinct regions of the nucleus. The largest encoded protein (major isoform) has been localized to the nucleolus and shown to participate in ribosome biosynthesis (PMID: 15469983, 16782053), while the minor isoform has been localized to the nucleoplasmin. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. Highest level of expression in heart, placenta, skeletal muscle, pancreas and retina. |
Form : | Lyophilised:Reconstitute with 60 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVP NVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVT PAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSD RETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDII DPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPL DADVNLEAIAGDLRCDCYTGADLSALVREASICALRQE MARQKSGNEKGELKVSHKHFEEAFKKVRSSIS |
Sequence Similarities : | Belongs to the AAA ATPase family. |
Gene Name | NVL nuclear VCP-like [ Homo sapiens ] |
Official Symbol | NVL |
Synonyms | NVL; nuclear VCP-like; nuclear valosin-containing protein-like; Nuclear valosin containing protein like; nuclear VCP like protein; |
Gene ID | 4931 |
mRNA Refseq | NM_001243146 |
Protein Refseq | NP_001230075 |
MIM | 602426 |
Uniprot ID | O15381 |
Chromosome Location | 1q41-q42.2 |
Pathway | Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; |
Function | ATP binding; nucleoside-triphosphatase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
NVL-11012M | Recombinant Mouse NVL Protein | +Inquiry |
NVL-12649Z | Recombinant Zebrafish NVL | +Inquiry |
NVL-6284M | Recombinant Mouse NVL Protein, His (Fc)-Avi-tagged | +Inquiry |
NVL-1426H | Recombinant Human NVL, His-tagged | +Inquiry |
Nvl-4561M | Recombinant Mouse Nvl Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NVL-1237HCL | Recombinant Human NVL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NVL Products
Required fields are marked with *
My Review for All NVL Products
Required fields are marked with *
0
Inquiry Basket