Recombinant Human NXT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NXT1-5172H
Product Overview : NXT1 MS Standard C13 and N15-labeled recombinant protein (NP_037380) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene.
Molecular Mass : 15.8 kDa
AA Sequence : MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NXT1 NTF2-like export factor 1 [ Homo sapiens (human) ]
Official Symbol NXT1
Synonyms NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15; protein p15; NTX2-like export factor1; NUTF-like export factor 1;
Gene ID 29107
mRNA Refseq NM_013248
Protein Refseq NP_037380
MIM 605811
UniProt ID Q9UKK6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NXT1 Products

Required fields are marked with *

My Review for All NXT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon