Recombinant Human OBP2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OBP2A-6264H
Product Overview : OBP2A MS Standard C13 and N15-labeled recombinant protein (NP_055397) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Molecular Mass : 19.32 kDa
AA Sequence : MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OBP2A odorant binding protein 2A [ Homo sapiens (human) ]
Official Symbol OBP2A
Synonyms OBP2A; OBP; OBP2C; OBPIIa; hOBPIIa; odorant binding protein 2A; odorant-binding protein 2a; odorant-binding protein Iia; putative odorant-binding protein 2c
Gene ID 29991
mRNA Refseq NM_014582
Protein Refseq NP_055397
MIM 164320
UniProt ID Q9NY56

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OBP2A Products

Required fields are marked with *

My Review for All OBP2A Products

Required fields are marked with *

0
cart-icon
0
compare icon