Recombinant Human OBP2A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OBP2A-6264H |
Product Overview : | OBP2A MS Standard C13 and N15-labeled recombinant protein (NP_055397) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Molecular Mass : | 19.32 kDa |
AA Sequence : | MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OBP2A odorant binding protein 2A [ Homo sapiens (human) ] |
Official Symbol | OBP2A |
Synonyms | OBP2A; OBP; OBP2C; OBPIIa; hOBPIIa; odorant binding protein 2A; odorant-binding protein 2a; odorant-binding protein Iia; putative odorant-binding protein 2c |
Gene ID | 29991 |
mRNA Refseq | NM_014582 |
Protein Refseq | NP_055397 |
MIM | 164320 |
UniProt ID | Q9NY56 |
◆ Recombinant Proteins | ||
OBP2A-4843H | Recombinant Human OBP2A protein, His-SUMO-tagged | +Inquiry |
Obp2a-109M | Active Recombinant Mouse Lair1 protein | +Inquiry |
OBP2A-6742H | Recombinant Human OBP2A protein, His-SUMO-tagged | +Inquiry |
Obp2a-1881M | Recombinant Mouse Obp2a Protein, His&GST-tagged | +Inquiry |
OBP2A-1880H | Recombinant Human OBP2A Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OBP2A-3609HCL | Recombinant Human OBP2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OBP2A Products
Required fields are marked with *
My Review for All OBP2A Products
Required fields are marked with *