Recombinant Human OCA2 protein, His-tagged
Cat.No. : | OCA2-2919H |
Product Overview : | Recombinant Human OCA2 protein(1-174 aa), fused to His tag, was expressed in E. coli. |
Availability | August 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-174 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | OCA2 oculocutaneous albinism II [ Homo sapiens ] |
Official Symbol | OCA2 |
Synonyms | OCA2; oculocutaneous albinism II; D15S12, EYCL2, EYCL3, eye color 2 (central brown) , eye color 3 (brown) , oculocutaneous albinism II (pink eye dilution (murine) homolog) , oculocutaneous albinism II (pink eye dilution homolog, mouse) , P; P protein; BEY; BEY1; BEY2; EYCL; melanocyte specific transporter protein; eye color 3 (brown); hair color 3 (brown); eye color 2 (central brown); total brown iris pigmentation; pink-eyed dilution protein homolog; melanocyte-specific transporter protein; oculocutaneous albinism II (pink-eye dilution homolog, mouse); P; PED; BOCA; HCL3; EYCL2; EYCL3; SHEP1; D15S12; |
Gene ID | 4948 |
mRNA Refseq | NM_000275 |
Protein Refseq | NP_000266 |
MIM | 611409 |
UniProt ID | Q04671 |
◆ Recombinant Proteins | ||
OCA2-2919H | Recombinant Human OCA2 protein, His-tagged | +Inquiry |
OCA2-30532TH | Recombinant Human OCA2 | +Inquiry |
OCA2-6306M | Recombinant Mouse OCA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
OCA2-11062M | Recombinant Mouse OCA2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OCA2 Products
Required fields are marked with *
My Review for All OCA2 Products
Required fields are marked with *