Recombinant Human OCA2 protein, His-tagged

Cat.No. : OCA2-2919H
Product Overview : Recombinant Human OCA2 protein(1-174 aa), fused to His tag, was expressed in E. coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-174 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRC
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name OCA2 oculocutaneous albinism II [ Homo sapiens ]
Official Symbol OCA2
Synonyms OCA2; oculocutaneous albinism II; D15S12, EYCL2, EYCL3, eye color 2 (central brown) , eye color 3 (brown) , oculocutaneous albinism II (pink eye dilution (murine) homolog) , oculocutaneous albinism II (pink eye dilution homolog, mouse) , P; P protein; BEY; BEY1; BEY2; EYCL; melanocyte specific transporter protein; eye color 3 (brown); hair color 3 (brown); eye color 2 (central brown); total brown iris pigmentation; pink-eyed dilution protein homolog; melanocyte-specific transporter protein; oculocutaneous albinism II (pink-eye dilution homolog, mouse); P; PED; BOCA; HCL3; EYCL2; EYCL3; SHEP1; D15S12;
Gene ID 4948
mRNA Refseq NM_000275
Protein Refseq NP_000266
MIM 611409
UniProt ID Q04671

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OCA2 Products

Required fields are marked with *

My Review for All OCA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon