Recombinant Human OCLN
Cat.No. : | OCLN-27768TH |
Product Overview : | Recombinant fragment corresponding to amino acids 423-522 of Human Occludin with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT |
Sequence Similarities : | Belongs to the ELL/occludin family.Contains 1 MARVEL domain. |
Gene Name | OCLN occludin [ Homo sapiens ] |
Official Symbol | OCLN |
Synonyms | OCLN; occludin; tight junction protein occludin TM4 minus; |
Gene ID | 100506658 |
mRNA Refseq | NM_001205254 |
Protein Refseq | NP_001192183 |
MIM | 602876 |
Uniprot ID | Q16625 |
Chromosome Location | 5q13.1 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; |
Function | protein binding; structural molecule activity; thiopurine S-methyltransferase activity; |
◆ Recombinant Proteins | ||
RFL2330RF | Recombinant Full Length Rat Occludin(Ocln) Protein, His-Tagged | +Inquiry |
RFL1932XF | Recombinant Full Length Xenopus Laevis Occludin(Ocln) Protein, His-Tagged | +Inquiry |
Ocln-4569M | Recombinant Mouse Ocln Protein, Myc/DDK-tagged | +Inquiry |
OCLN-4153R | Recombinant Rat OCLN Protein | +Inquiry |
OCLN-352HF | Recombinant Full Length Human OCLN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCLN-3603HCL | Recombinant Human OCLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OCLN Products
Required fields are marked with *
My Review for All OCLN Products
Required fields are marked with *