Recombinant Human OCLN

Cat.No. : OCLN-27768TH
Product Overview : Recombinant fragment corresponding to amino acids 423-522 of Human Occludin with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Sequence Similarities : Belongs to the ELL/occludin family.Contains 1 MARVEL domain.
Gene Name OCLN occludin [ Homo sapiens ]
Official Symbol OCLN
Synonyms OCLN; occludin; tight junction protein occludin TM4 minus;
Gene ID 100506658
mRNA Refseq NM_001205254
Protein Refseq NP_001192183
MIM 602876
Uniprot ID Q16625
Chromosome Location 5q13.1
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem;
Function protein binding; structural molecule activity; thiopurine S-methyltransferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OCLN Products

Required fields are marked with *

My Review for All OCLN Products

Required fields are marked with *

0
cart-icon
0
compare icon