Recombinant Human OCLN
| Cat.No. : | OCLN-27768TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 423-522 of Human Occludin with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT |
| Sequence Similarities : | Belongs to the ELL/occludin family.Contains 1 MARVEL domain. |
| Gene Name | OCLN occludin [ Homo sapiens ] |
| Official Symbol | OCLN |
| Synonyms | OCLN; occludin; tight junction protein occludin TM4 minus; |
| Gene ID | 100506658 |
| mRNA Refseq | NM_001205254 |
| Protein Refseq | NP_001192183 |
| MIM | 602876 |
| Uniprot ID | Q16625 |
| Chromosome Location | 5q13.1 |
| Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; |
| Function | protein binding; structural molecule activity; thiopurine S-methyltransferase activity; |
| ◆ Recombinant Proteins | ||
| OCLN-6685C | Recombinant Chicken OCLN | +Inquiry |
| Ocln-4569M | Recombinant Mouse Ocln Protein, Myc/DDK-tagged | +Inquiry |
| RFL15045CF | Recombinant Full Length Dog Occludin(Ocln) Protein, His-Tagged | +Inquiry |
| Ocln-1882M | Recombinant Mouse Ocln Protein, His-tagged | +Inquiry |
| OCLN-9487HFL | Recombinant Full Length Human OCLN protein, Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OCLN-3603HCL | Recombinant Human OCLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OCLN Products
Required fields are marked with *
My Review for All OCLN Products
Required fields are marked with *




