Recombinant Human ODF3L1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ODF3L1-6578H |
| Product Overview : | ODF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_787077) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ODF3L1 (Outer Dense Fiber Of Sperm Tails 3 Like 1) is a Protein Coding gene. An important paralog of this gene is ODF3L2. |
| Molecular Mass : | 31.1 kDa |
| AA Sequence : | MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSCTGYIDHDISMFKAPAYTLHSRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTLASCQYYFEKIHPPGERRAPQYTFGYRRPYRVMDLNPAPNQYQMPLLLGPNTPVSRAAPCYSLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYSMAKRFAYPLDLTPRPGPGSHEVQQVTVHKPHIPAFTMGIKHSLHLCPLVIDIRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ODF3L1 outer dense fiber of sperm tails 3-like 1 [ Homo sapiens (human) ] |
| Official Symbol | ODF3L1 |
| Synonyms | ODF3L1; outer dense fiber of sperm tails 3-like 1; outer dense fiber protein 3-like protein 1; MGC48986; |
| Gene ID | 161753 |
| mRNA Refseq | NM_175881 |
| Protein Refseq | NP_787077 |
| UniProt ID | Q8IXM7 |
| ◆ Recombinant Proteins | ||
| ODF3L1-6318M | Recombinant Mouse ODF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ODF3L1-1665H | Recombinant Human ODF3L1 | +Inquiry |
| ODF3L1-3717H | Recombinant Human ODF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ODF3L1-11077M | Recombinant Mouse ODF3L1 Protein | +Inquiry |
| Odf3l1-4575M | Recombinant Mouse Odf3l1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ODF3L1-3596HCL | Recombinant Human ODF3L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ODF3L1 Products
Required fields are marked with *
My Review for All ODF3L1 Products
Required fields are marked with *
