Recombinant Human OLFM1, His-tagged

Cat.No. : OLFM1-30337TH
Product Overview : Recombinant fragment, corresponding to amino acids 33-125 of Human Noelin Isoform 4 with N terminal His tag; Predicted MWt 12 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 33-125 a.a.
Description : This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 126 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK VQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQ VEESHKQHLARQFKG
Sequence Similarities : Contains 1 olfactomedin-like domain.
Gene Name OLFM1 olfactomedin 1 [ Homo sapiens ]
Official Symbol OLFM1
Synonyms OLFM1; olfactomedin 1; noelin; AMY; NOE1; NOELIN; OlfA;
Gene ID 10439
mRNA Refseq NM_006334
Protein Refseq NP_006325
MIM 605366
Uniprot ID Q99784
Chromosome Location 9q34.3
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OLFM1 Products

Required fields are marked with *

My Review for All OLFM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon