Recombinant Human OLFML3, His-tagged

Cat.No. : OLFML3-107H
Product Overview : Recombinant Human Olfactomedin-Like Protein 3/OLFML3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln22-Val406) of Human OLFML3 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-406 a.a.
Description : Olfactomedin-Like Protein 3 (OLFML3) belongs to the OLFML3 family. OLFML3 is a secreted protein and contains one olfactomedin-like domain. In term placenta, OLFML3 is mainly localized extracellularly surrounding the syncytiotrophoblastic cells. OLFML3 is highly expressed in the placenta, moderate expressed in the liver and heart, with fairly weak expression in other tissues. It is shown that OLFML3 may have matrix-related function involved in human placental and embryonic development, or it may play a similar role in other physiological processes. In addition, OLFML3 plays an essential role in dorso-ventral patterning during early development.
AA Sequence : QQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGR VDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNEKYDMVTDCGYTISQVRSMKILKRF GGPAGLWTKDPLGQTEKIYVLDGTQNDTAFVFPRLRDFTLAMAARKASRVRVPFPWVGTGQLVYG GFLYFARRPPGRPGGGGEMENTLQLIKFHLANRTVVDSSVFPAEGLIPPYGLTADTYIDLAADEE GLWAVYATREDDRHLCLAKLDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQ CSFDASGTLTPERAALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEVVDHHH HHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name OLFML3 olfactomedin-like 3 [ Homo sapiens ]
Official Symbol OLFML3
Synonyms OLFML3; olfactomedin-like 3; olfactomedin-like protein 3; HNOEL iso; OLF44; hOLF44; HNOEL-iso;
Gene ID 56944
mRNA Refseq NM_020190
Protein Refseq NP_064575
MIM 610088
UniProt ID Q9NRN5
Chromosome Location 1p13.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OLFML3 Products

Required fields are marked with *

My Review for All OLFML3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon