Recombinant Human OLFML3, His-tagged
Cat.No. : | OLFML3-107H |
Product Overview : | Recombinant Human Olfactomedin-Like Protein 3/OLFML3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln22-Val406) of Human OLFML3 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-406 a.a. |
Description : | Olfactomedin-Like Protein 3 (OLFML3) belongs to the OLFML3 family. OLFML3 is a secreted protein and contains one olfactomedin-like domain. In term placenta, OLFML3 is mainly localized extracellularly surrounding the syncytiotrophoblastic cells. OLFML3 is highly expressed in the placenta, moderate expressed in the liver and heart, with fairly weak expression in other tissues. It is shown that OLFML3 may have matrix-related function involved in human placental and embryonic development, or it may play a similar role in other physiological processes. In addition, OLFML3 plays an essential role in dorso-ventral patterning during early development. |
AA Sequence : | QQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGR VDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNEKYDMVTDCGYTISQVRSMKILKRF GGPAGLWTKDPLGQTEKIYVLDGTQNDTAFVFPRLRDFTLAMAARKASRVRVPFPWVGTGQLVYG GFLYFARRPPGRPGGGGEMENTLQLIKFHLANRTVVDSSVFPAEGLIPPYGLTADTYIDLAADEE GLWAVYATREDDRHLCLAKLDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQ CSFDASGTLTPERAALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEVVDHHH HHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | OLFML3 olfactomedin-like 3 [ Homo sapiens ] |
Official Symbol | OLFML3 |
Synonyms | OLFML3; olfactomedin-like 3; olfactomedin-like protein 3; HNOEL iso; OLF44; hOLF44; HNOEL-iso; |
Gene ID | 56944 |
mRNA Refseq | NM_020190 |
Protein Refseq | NP_064575 |
MIM | 610088 |
UniProt ID | Q9NRN5 |
Chromosome Location | 1p13.1 |
◆ Recombinant Proteins | ||
OLFML3-11103M | Recombinant Mouse OLFML3 Protein | +Inquiry |
OLFML3-3406C | Recombinant Chicken OLFML3 | +Inquiry |
OLFML3-17H | Recombinant Human OLFML3, MYC/DDK-tagged | +Inquiry |
OLFML3-2983R | Recombinant Rhesus Macaque OLFML3 Protein, His (Fc)-Avi-tagged | +Inquiry |
OLFML3-1815H | Recombinant Human OLFML3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLFML3-3578HCL | Recombinant Human OLFML3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLFML3 Products
Required fields are marked with *
My Review for All OLFML3 Products
Required fields are marked with *