Recombinant Human OMG protein, His tagged

Cat.No. : OMG-012H
Product Overview : Recombinant human OMG, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 25-417aa
Description : Predicted to enable identical protein binding activity. Predicted to be involved in neuron projection regeneration. Predicted to act upstream of or within regulation of collateral sprouting of intact axon in response to injury. Predicted to be located in plasma membrane.
Form : Liquid
AASequence : ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPS
Molecular Mass : 45.4 kDa (401aa)
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Application : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Reference : 1. Kottis V., et al. (2002) J Neurochem. 82:1566-1569. 2. Habib AA., et al. (1998) J Neurochem. 70:1704-1711
Gene Name OMG oligodendrocyte myelin glycoprotein [ Homo sapiens (human) ]
Official Symbol OMG
Synonyms OMG; oligodendrocyte myelin glycoprotein; OMGP; oligodendrocyte-myelin glycoprotein
Gene ID 4974
mRNA Refseq NM_002544
Protein Refseq NP_002535
MIM 164345
UniProt ID P23515

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OMG Products

Required fields are marked with *

My Review for All OMG Products

Required fields are marked with *

0
cart-icon
0
compare icon