Recombinant Human OMG protein, His tagged
Cat.No. : | OMG-012H |
Product Overview : | Recombinant human OMG, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 25-417aa |
Description : | Predicted to enable identical protein binding activity. Predicted to be involved in neuron projection regeneration. Predicted to act upstream of or within regulation of collateral sprouting of intact axon in response to injury. Predicted to be located in plasma membrane. |
Form : | Liquid |
AASequence : | ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPS |
Molecular Mass : | 45.4 kDa (401aa) |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Application : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Reference : | 1. Kottis V., et al. (2002) J Neurochem. 82:1566-1569. 2. Habib AA., et al. (1998) J Neurochem. 70:1704-1711 |
Gene Name | OMG oligodendrocyte myelin glycoprotein [ Homo sapiens (human) ] |
Official Symbol | OMG |
Synonyms | OMG; oligodendrocyte myelin glycoprotein; OMGP; oligodendrocyte-myelin glycoprotein |
Gene ID | 4974 |
mRNA Refseq | NM_002544 |
Protein Refseq | NP_002535 |
MIM | 164345 |
UniProt ID | P23515 |
◆ Recombinant Proteins | ||
OMG-1893H | Active Recombinant Human Oligodendrocyte Myelin Glycoprotein, His-tagged | +Inquiry |
OMG-3167R | Recombinant Rhesus monkey OMG Protein, His-tagged | +Inquiry |
OMG-3726H | Recombinant Human OMG Protein, His (Fc)-Avi-tagged | +Inquiry |
OMG-827H | Recombinant Human OMG Protein, His-tagged | +Inquiry |
OMG-3824H | Recombinant Human OMG protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
OMG-012H | Recombinant Human OMG protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OMG-1924HCL | Recombinant Human OMG cell lysate | +Inquiry |
OMG-1923HCL | Recombinant Human OMG cell lysate | +Inquiry |
OMG-1895MCL | Recombinant Mouse OMG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OMG Products
Required fields are marked with *
My Review for All OMG Products
Required fields are marked with *