Recombinant Human OMG protein, His tagged

• Cat.No.: OMG-012H
• Product Overview: Recombinant human OMG, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 25-417aa
• Description: Predicted to enable identical protein binding activity. Predicted to be involved in neuron projection regeneration. Predicted to act upstream of or within regulation of collateral sprouting of intact axon in response to injury. Predicted to be located in plasma membrane.
• Form: Liquid
• AASequence: ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPS
• Molecular Mass: 45.4 kDa (401aa)
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Application: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Reference: 1. Kottis V., et al. (2002) J Neurochem. 82:1566-1569. 2. Habib AA., et al. (1998) J Neurochem. 70:1704-1711

Gene Information

• Gene Name: OMG oligodendrocyte myelin glycoprotein [ Homo sapiens (human) ]
• Official Symbol: OMG
• Synonyms: OMG; oligodendrocyte myelin glycoprotein; OMGP; oligodendrocyte-myelin glycoprotein
• Gene ID: 4974
• mRNA Refseq: NM_002544
• Protein Refseq: NP_002535
• MIM: 164345
• UniProt ID: P23515