Recombinant Human ONECUT1 protein, His-tagged
Cat.No. : | ONECUT1-1459H |
Product Overview : | Recombinant Human ONECUT1 protein(167-292 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 167-292 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEI |
Gene Name | ONECUT1 one cut homeobox 1 [ Homo sapiens ] |
Official Symbol | ONECUT1 |
Synonyms | ONECUT1; one cut homeobox 1; HNF6, HNF6A, one cut domain, family member 1; hepatocyte nuclear factor 6; HNF 6; one cut domain family member 1; one cut domain, family member 1; hepatocyte nuclear factor 6, alpha; HNF6; HNF-6; HNF6A; |
Gene ID | 3175 |
mRNA Refseq | NM_004498 |
Protein Refseq | NP_004489 |
MIM | 604164 |
UniProt ID | Q9UBC0 |
◆ Recombinant Proteins | ||
ONECUT1-1458H | Recombinant Human ONECUT1, GST-tagged | +Inquiry |
ONECUT1-128H | Recombinant Human ONECUT1 | +Inquiry |
ONECUT1-12153M | Recombinant Mouse ONECUT1 Protein | +Inquiry |
ONECUT1-3848R | Recombinant Rat ONECUT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ONECUT1-29373TH | Recombinant Human ONECUT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ONECUT1-3576HCL | Recombinant Human ONECUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ONECUT1 Products
Required fields are marked with *
My Review for All ONECUT1 Products
Required fields are marked with *