Recombinant Human OPA1

Cat.No. : OPA1-30511TH
Product Overview : Recombinant fragment corresponding to amino acids 851-960 of Human OPA1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Highly expressed in retina. Also expressed in brain, testis, heart and skeletal muscle. Isoform 1 expressed in retina, skeletal muscle, heart, lung, ovary, colon, thyroid gland, leukocytes and fetal brain. Isoform 2 expressed in colon, liver, kidney, thyr
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAIT ANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTG KRVQLAEDLKKVREIQEKLDAFIEALHQEK
Sequence Similarities : Belongs to the dynamin family.
Gene Name OPA1 optic atrophy 1 (autosomal dominant) [ Homo sapiens ]
Official Symbol OPA1
Synonyms OPA1; optic atrophy 1 (autosomal dominant); dynamin-like 120 kDa protein, mitochondrial; FLJ12460; KIAA0567; MGM1; mitochondrial dynamin like GTPase; NPG; NTG;
Gene ID 4976
mRNA Refseq NM_015560
Protein Refseq NP_056375
MIM 605290
Uniprot ID O60313
Chromosome Location 3q28-q29
Function GTP binding; GTPase activity; magnesium ion binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OPA1 Products

Required fields are marked with *

My Review for All OPA1 Products

Required fields are marked with *

0
cart-icon