Recombinant Human OPA1

• Cat.No.: OPA1-30511TH
• Product Overview: Recombinant fragment corresponding to amino acids 851-960 of Human OPA1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Highly expressed in retina. Also expressed in brain, testis, heart and skeletal muscle. Isoform 1 expressed in retina, skeletal muscle, heart, lung, ovary, colon, thyroid gland, leukocytes and fetal brain. Isoform 2 expressed in colon, liver, kidney, thyr
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAIT ANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTG KRVQLAEDLKKVREIQEKLDAFIEALHQEK
• Sequence Similarities: Belongs to the dynamin family.

Gene Information

• Gene Name: OPA1 optic atrophy 1 (autosomal dominant) [ Homo sapiens ]
• Official Symbol: OPA1
• Synonyms: OPA1; optic atrophy 1 (autosomal dominant); dynamin-like 120 kDa protein, mitochondrial; FLJ12460; KIAA0567; MGM1; mitochondrial dynamin like GTPase; NPG; NTG
• Gene ID: 4976
• mRNA Refseq: NM_015560
• Protein Refseq: NP_056375
• MIM: 605290
• Uniprot ID: O60313
• Chromosome Location: 3q28-q29
• Function: GTP binding; GTPase activity; magnesium ion binding; nucleotide binding; protein binding