Recombinant Human OPCML Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OPCML-2076H |
Product Overview : | OPCML MS Standard C13 and N15-labeled recombinant protein (NP_001012393) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily of proteins. The encoded preprotein is proteolytically processed to generate the mature protein. This protein is localized in the plasma membrane and may have an accessory role in opioid receptor function. This gene has an ortholog in rat and bovine. The opioid binding-cell adhesion molecule encoded by the rat gene binds opioid alkaloids in the presence of acidic lipids, exhibits selectivity for mu ligands and acts as a GPI-anchored protein. Since the encoded protein is highly conserved in species during evolution, it may have a fundamental role in mammalian systems. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
Molecular Mass : | 37.27 kDa |
AA Sequence : | MYHPAYWVVFSATTALLFIPGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OPCML opioid binding protein/cell adhesion molecule-like [ Homo sapiens (human) ] |
Official Symbol | OPCML |
Synonyms | OPCML; opioid binding protein/cell adhesion molecule-like; opioid binding protein/cell adhesion molecule like; opioid-binding protein/cell adhesion molecule; IgLON family member 1; IGLON1; OBCAM; OPCM; opioid binding protein/cell adhesion molecule-like preprotein; |
Gene ID | 4978 |
mRNA Refseq | NM_001012393 |
Protein Refseq | NP_001012393 |
MIM | 600632 |
UniProt ID | Q14982 |
◆ Recombinant Proteins | ||
Opcml-4593M | Recombinant Mouse Opcml Protein, Myc/DDK-tagged | +Inquiry |
OPCML-294H | Recombinant Human OPCML Protein, MYC/DDK-tagged | +Inquiry |
Opcml-510R | Recombinant Rat Opcml protein(Met1-Val321), hFc-tagged | +Inquiry |
OPCML-2076H | Recombinant Human OPCML Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OPCML-819H | Recombinant Human OPCML protein(Met1-Asn322), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OPCML-899MCL | Recombinant Mouse OPCML cell lysate | +Inquiry |
OPCML-2877HCL | Recombinant Human OPCML cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPCML Products
Required fields are marked with *
My Review for All OPCML Products
Required fields are marked with *
0
Inquiry Basket