Recombinant Human OPCML Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OPCML-2076H
Product Overview : OPCML MS Standard C13 and N15-labeled recombinant protein (NP_001012393) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily of proteins. The encoded preprotein is proteolytically processed to generate the mature protein. This protein is localized in the plasma membrane and may have an accessory role in opioid receptor function. This gene has an ortholog in rat and bovine. The opioid binding-cell adhesion molecule encoded by the rat gene binds opioid alkaloids in the presence of acidic lipids, exhibits selectivity for mu ligands and acts as a GPI-anchored protein. Since the encoded protein is highly conserved in species during evolution, it may have a fundamental role in mammalian systems. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Molecular Mass : 37.27 kDa
AA Sequence : MYHPAYWVVFSATTALLFIPGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OPCML opioid binding protein/cell adhesion molecule-like [ Homo sapiens (human) ]
Official Symbol OPCML
Synonyms OPCML; opioid binding protein/cell adhesion molecule-like; opioid binding protein/cell adhesion molecule like; opioid-binding protein/cell adhesion molecule; IgLON family member 1; IGLON1; OBCAM; OPCM; opioid binding protein/cell adhesion molecule-like preprotein;
Gene ID 4978
mRNA Refseq NM_001012393
Protein Refseq NP_001012393
MIM 600632
UniProt ID Q14982

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OPCML Products

Required fields are marked with *

My Review for All OPCML Products

Required fields are marked with *

0
cart-icon
0
compare icon