Recombinant Human OPLAH protein, His&Myc-tagged
Cat.No. : | OPLAH-4449H |
Product Overview : | Recombinant Human OPLAH protein(O14841)(209-302aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 209-302aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.4 kDa |
AA Sequence : | RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | OPLAH 5-oxoprolinase (ATP-hydrolysing) [ Homo sapiens ] |
Official Symbol | OPLAH |
Synonyms | OPLAH; 5-oxoprolinase (ATP-hydrolysing); 5-oxoprolinase; 5 Opase; OPLA; pyroglutamase; 5-oxo-L-prolinase; OPLAHD; 5-Opase; DKFZp434H244; |
Gene ID | 26873 |
mRNA Refseq | NM_017570 |
Protein Refseq | NP_060040 |
MIM | 614243 |
UniProt ID | O14841 |
◆ Recombinant Proteins | ||
OPLAH-12167M | Recombinant Mouse OPLAH Protein | +Inquiry |
OPLAH-302H | Recombinant Human OPLAH Protein, MYC/DDK-tagged | +Inquiry |
OPLAH-4449H | Recombinant Human OPLAH protein, His&Myc-tagged | +Inquiry |
OPLAH-7910Z | Recombinant Zebrafish OPLAH | +Inquiry |
OPLAH-6397M | Recombinant Mouse OPLAH Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OPLAH Products
Required fields are marked with *
My Review for All OPLAH Products
Required fields are marked with *
0
Inquiry Basket