Recombinant Human OPLAH protein, His&Myc-tagged

Cat.No. : OPLAH-4449H
Product Overview : Recombinant Human OPLAH protein(O14841)(209-302aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 209-302aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.4 kDa
AA Sequence : RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name OPLAH 5-oxoprolinase (ATP-hydrolysing) [ Homo sapiens ]
Official Symbol OPLAH
Synonyms OPLAH; 5-oxoprolinase (ATP-hydrolysing); 5-oxoprolinase; 5 Opase; OPLA; pyroglutamase; 5-oxo-L-prolinase; OPLAHD; 5-Opase; DKFZp434H244;
Gene ID 26873
mRNA Refseq NM_017570
Protein Refseq NP_060040
MIM 614243
UniProt ID O14841

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OPLAH Products

Required fields are marked with *

My Review for All OPLAH Products

Required fields are marked with *

0
cart-icon