Recombinant Human OR13A1 Full Length Transmembrane protein, His-tagged

• Cat.No.: OR13A1-1313H
• Product Overview: Recombinant Human OR13A1 protein(Q8NGR1)(1-328aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-328aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.3 kDa
• AA Sequence: MKLWMESHLIVPETRPSPRMMSNQTLVTEFILQGFSEHPEYRVFLFSCFLFLYSGALTGN VLITLAITFNPGLHAPMYFFLLNLATMDIICTSSIMPKALASLVSEESSISYGGCMAQLY FLTWAASSELLLLTVMAYDRYAAICHPLHYSSMMSKVFCSGLATAVWLLCAVNTAIHTGL MLRLDFCGPNVIIHFFCEVPPLLLLSCSSTYVNGVMIVLADAFYGIVNFLMTIASYGFIV SSILKVKTAWGRQKAFSTCSSHLTVVCMYYTAVFYAYISPVSGYSAGKSKLAGLLYTVLS PTLNPLIYTLRNKEVKAALRKLFPFFRN
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: OR13A1 olfactory receptor, family 13, subfamily A, member 1 [Homo sapiens (human) ]
• Official Symbol: OR13A1
• Synonyms: OR13A1; olfactory receptor, family 13, subfamily A, member 1; olfactory receptor 13A1; olfactory receptor OR10-3; seven transmembrane helix receptor; olfactory receptor 2L13; olfactory receptor 2L14; olfactory receptor, family 2, subfamily L, member 14
• Gene ID: 79290
• mRNA Refseq: NM_001004297
• Protein Refseq: NP_001004297
• UniProt ID: Q8NGR1