Recombinant Human ORC4 Protein (1-436 aa), His-SUMO-tagged
Cat.No. : | ORC4-703H |
Product Overview : | Recombinant Human ORC4 Protein (1-436 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-436 aa |
Description : | Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 66.4 kDa |
AA Sequence : | MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ORC4 origin recognition complex, subunit 4 [ Homo sapiens ] |
Official Symbol | ORC4 |
Synonyms | ORC4; HsORC4; Orc4p; ORC4L; ORC4P; FLJ46668; |
Gene ID | 5000 |
mRNA Refseq | NM_001190879 |
Protein Refseq | NP_001177808 |
MIM | 603056 |
UniProt ID | O43929 |
◆ Recombinant Proteins | ||
ORC4-288H | Recombinant Human ORC4 Protein, MYC/DDK-tagged | +Inquiry |
ORC4-703H | Recombinant Human ORC4 Protein (1-436 aa), His-SUMO-tagged | +Inquiry |
ORC4-513C | Recombinant Cynomolgus Monkey ORC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ORC4-2850H | Recombinant Human ORC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ORC4-12395Z | Recombinant Zebrafish ORC4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORC4 Products
Required fields are marked with *
My Review for All ORC4 Products
Required fields are marked with *
0
Inquiry Basket