Recombinant Human OSBPL3 Protein, His-tagged

Cat.No. : OSBPL3-22H
Product Overview : Recombinant Human OSBPL3 Protein(Q9H4L5)(261-340 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 261-340 aa
Form : Phosphate buffered saline
Molecular Mass : 11 kDa
AASequence : GSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIA
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name OSBPL3 oxysterol binding protein-like 3 [ Homo sapiens ]
Official Symbol OSBPL3
Synonyms OSBPL3; oxysterol binding protein-like 3; OSBP3; oxysterol-binding protein-related protein 3; KIAA0704; ORP 3; ORP3; OSBP-related protein 3; oxysterol-binding protein 3; ORP-3; MGC21526; DKFZp667P1518;
Gene ID 26031
mRNA Refseq NM_015550
Protein Refseq NP_056365
MIM 606732
UniProt ID Q9H4L5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSBPL3 Products

Required fields are marked with *

My Review for All OSBPL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon