Recombinant Human OSBPL3 Protein, His-tagged
| Cat.No. : | OSBPL3-22H |
| Product Overview : | Recombinant Human OSBPL3 Protein(Q9H4L5)(261-340 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 261-340 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| AASequence : | GSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIA |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | OSBPL3 oxysterol binding protein-like 3 [ Homo sapiens ] |
| Official Symbol | OSBPL3 |
| Synonyms | OSBPL3; oxysterol binding protein-like 3; OSBP3; oxysterol-binding protein-related protein 3; KIAA0704; ORP 3; ORP3; OSBP-related protein 3; oxysterol-binding protein 3; ORP-3; MGC21526; DKFZp667P1518; |
| Gene ID | 26031 |
| mRNA Refseq | NM_015550 |
| Protein Refseq | NP_056365 |
| MIM | 606732 |
| UniProt ID | Q9H4L5 |
| ◆ Recombinant Proteins | ||
| Osbpl3-4610M | Recombinant Mouse Osbpl3 Protein, Myc/DDK-tagged | +Inquiry |
| OSBPL3-09HFL | Recombinant Full Length Human OSBPL3 Protein, Flag tagged | +Inquiry |
| OSBPL3-3225H | Recombinant Human OSBPL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| OSBPL3-22H | Recombinant Human OSBPL3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSBPL3-3536HCL | Recombinant Human OSBPL3 293 Cell Lysate | +Inquiry |
| OSBPL3-3535HCL | Recombinant Human OSBPL3 293 Cell Lysate | +Inquiry |
| OSBPL3-3537HCL | Recombinant Human OSBPL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSBPL3 Products
Required fields are marked with *
My Review for All OSBPL3 Products
Required fields are marked with *



