Recombinant Human OSBPL3 Protein, His-tagged

• Cat.No.: OSBPL3-22H
• Product Overview: Recombinant Human OSBPL3 Protein(Q9H4L5)(261-340 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 261-340 aa
• Form: Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: GSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIA
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: OSBPL3 oxysterol binding protein-like 3 [ Homo sapiens ]
• Official Symbol: OSBPL3
• Synonyms: OSBPL3; oxysterol binding protein-like 3; OSBP3; oxysterol-binding protein-related protein 3; KIAA0704; ORP 3; ORP3; OSBP-related protein 3; oxysterol-binding protein 3; ORP-3; MGC21526; DKFZp667P1518
• Gene ID: 26031
• mRNA Refseq: NM_015550
• Protein Refseq: NP_056365
• MIM: 606732
• UniProt ID: Q9H4L5