Recombinant Human OSM protein, hFc-tagged
| Cat.No. : | OSM-2754H |
| Product Overview : | Recombinant Human OSM protein(P13725)(26-221aa), fused with N-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 26-221aa |
| Tag : | N-hFc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR |
| Gene Name | OSM oncostatin M [ Homo sapiens ] |
| Official Symbol | OSM |
| Synonyms | OSM; oncostatin M; oncostatin-M; MGC20461; |
| Gene ID | 5008 |
| mRNA Refseq | NM_020530 |
| Protein Refseq | NP_065391 |
| MIM | 165095 |
| UniProt ID | P13725 |
| ◆ Recombinant Proteins | ||
| OSM-358H | Recombinant Human Oncostatin M | +Inquiry |
| Osm-4358M | Recombinant Mouse Osm Protein | +Inquiry |
| OSM-2106H | Active Recombinant Human OSM protein | +Inquiry |
| OSM-964H | Recombinant Human OSM Protein | +Inquiry |
| Osm-4619M | Recombinant Mouse Osm Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
| OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
