Recombinant Human OSTC Protein, GST-tagged

Cat.No. : OSTC-26H
Product Overview : Recombinant Human OSTC(1 a.a. - 149 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 149 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.2 kDa
AA Sequence : METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG
Applications : Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name OSTC oligosaccharyltransferase complex subunit [ Homo sapiens ]
Official Symbol OSTC
Synonyms OSTC; oligosaccharyltransferase complex subunit; oligosaccharyltransferase complex subunit OSTC; DC2; DC2 protein; hydrophobic protein HSF-28;
Gene ID 58505
mRNA Refseq NM_021227
Protein Refseq NP_067050
UniProt ID Q9NRP0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSTC Products

Required fields are marked with *

My Review for All OSTC Products

Required fields are marked with *

0
cart-icon