Recombinant Human OSTF1, His-tagged
| Cat.No. : | OSTF1-28124TH |
| Product Overview : | Recombinant full length Human OSTF1 with C terminal His tag; 222 amino acids with a predicted MWt 25.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 214 amino acids |
| Description : | Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al. |
| Conjugation : | HIS |
| Molecular Weight : | 25.100kDa inclusive of tags |
| Tissue specificity : | Ubiquitously expressed. Present in osteoclasts (at protein level). |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.24% Tris, 0.01% DTT, 10% Glycerol |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSKPPPKPVKPGEGGQVKVFRALYTFEPRTPDELYFEEGD IIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPL HEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGG HKDIVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQ LFLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDA VRTLSNAEDYLDDEDSDLEHHHHHH |
| Sequence Similarities : | Contains 3 ANK repeats.Contains 1 SH3 domain. |
| Gene Name | OSTF1 osteoclast stimulating factor 1 [ Homo sapiens ] |
| Official Symbol | OSTF1 |
| Synonyms | OSTF1; osteoclast stimulating factor 1; osteoclast-stimulating factor 1; bA235O14.1; OSF; SH3P2; |
| Gene ID | 26578 |
| mRNA Refseq | NM_012383 |
| Protein Refseq | NP_036515 |
| MIM | 610180 |
| Uniprot ID | Q92882 |
| Chromosome Location | 9q13-q21.2 |
| Function | SH3 domain binding; |
| ◆ Recombinant Proteins | ||
| OSTF1-12221M | Recombinant Mouse OSTF1 Protein | +Inquiry |
| OSTF1-6422M | Recombinant Mouse OSTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| OSTF1-28251TH | Recombinant Human OSTF1, His-tagged | +Inquiry |
| OSTF1-3875R | Recombinant Rat OSTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| OSTF1-3075C | Recombinant Chicken OSTF1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSTF1-3520HCL | Recombinant Human OSTF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSTF1 Products
Required fields are marked with *
My Review for All OSTF1 Products
Required fields are marked with *



