Recombinant Human OSTF1, His-tagged
Cat.No. : | OSTF1-28124TH |
Product Overview : | Recombinant full length Human OSTF1 with C terminal His tag; 222 amino acids with a predicted MWt 25.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 214 amino acids |
Description : | Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al. |
Conjugation : | HIS |
Molecular Weight : | 25.100kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. Present in osteoclasts (at protein level). |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.24% Tris, 0.01% DTT, 10% Glycerol |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSKPPPKPVKPGEGGQVKVFRALYTFEPRTPDELYFEEGD IIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPL HEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGG HKDIVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQ LFLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDA VRTLSNAEDYLDDEDSDLEHHHHHH |
Sequence Similarities : | Contains 3 ANK repeats.Contains 1 SH3 domain. |
Gene Name | OSTF1 osteoclast stimulating factor 1 [ Homo sapiens ] |
Official Symbol | OSTF1 |
Synonyms | OSTF1; osteoclast stimulating factor 1; osteoclast-stimulating factor 1; bA235O14.1; OSF; SH3P2; |
Gene ID | 26578 |
mRNA Refseq | NM_012383 |
Protein Refseq | NP_036515 |
MIM | 610180 |
Uniprot ID | Q92882 |
Chromosome Location | 9q13-q21.2 |
Function | SH3 domain binding; |
◆ Recombinant Proteins | ||
OSTF1-12221M | Recombinant Mouse OSTF1 Protein | +Inquiry |
OSTF1-4213R | Recombinant Rat OSTF1 Protein | +Inquiry |
OSTF1-28124TH | Recombinant Human OSTF1, His-tagged | +Inquiry |
OSTF1-3875R | Recombinant Rat OSTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ostf1-7017M | Recombinant Mouse Ostf1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSTF1-3520HCL | Recombinant Human OSTF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSTF1 Products
Required fields are marked with *
My Review for All OSTF1 Products
Required fields are marked with *