Recombinant human OTOP1, GST tagged

• Cat.No.: OTOP1-1475H
• Product Overview: Recombinant human OTOP1 protein partial ORF ( NP_819056.1, 415 a.a. - 504 a.a.) was expressed in Wheat Germ, with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: Liquid
• Molecular Mass: 35.64 kDa
• AA Sequence: AEGHPRYTWYNLPYSILAIVEKYIQNLFIFESIHREPEKLSEDIQTLRVVTVCNGNTMPLASSCPKSGGVARDVA PQGKDMPPAANGNVC
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: OTOP1 otopetrin 1 [ Homo sapiens ]
• Official Symbol: OTOP1
• Synonyms: OTOP1; otopetrin 1; otopetrin-1; MGC163302; MGC163304
• Gene ID: 133060
• mRNA Refseq: NM_177998
• Protein Refseq: NP_819056
• MIM: 607806
• UniProt ID: Q7RTM1
• Chromosome Location: 4p16.2