Recombinant human OTOP1, GST tagged
Cat.No. : | OTOP1-1475H |
Product Overview : | Recombinant human OTOP1 protein partial ORF ( NP_819056.1, 415 a.a. - 504 a.a.) was expressed in Wheat Germ, with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | Liquid |
Molecular Mass : | 35.64 kDa |
AA Sequence : | AEGHPRYTWYNLPYSILAIVEKYIQNLFIFESIHREPEKLSEDIQTLRVVTVCNGNTMPLASSCPKSGGVARDVA PQGKDMPPAANGNVC |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | OTOP1 otopetrin 1 [ Homo sapiens ] |
Official Symbol | OTOP1 |
Synonyms | OTOP1; otopetrin 1; otopetrin-1; MGC163302; MGC163304; |
Gene ID | 133060 |
mRNA Refseq | NM_177998 |
Protein Refseq | NP_819056 |
MIM | 607806 |
UniProt ID | Q7RTM1 |
Chromosome Location | 4p16.2 |
◆ Recombinant Proteins | ||
OTOP1-4216R | Recombinant Rat OTOP1 Protein | +Inquiry |
OTOP1-1475H | Recombinant human OTOP1, GST tagged | +Inquiry |
Otop1-4452M | Recombinant Mouse Otop1 Full Length Transmembrane protein, His-tagged | +Inquiry |
OTOP1-3878R | Recombinant Rat OTOP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OTOP1-1476H | Recombinant Human OTOP1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTOP1 Products
Required fields are marked with *
My Review for All OTOP1 Products
Required fields are marked with *
0
Inquiry Basket