Recombinant human OTOP1, GST tagged
| Cat.No. : | OTOP1-1475H |
| Product Overview : | Recombinant human OTOP1 protein partial ORF ( NP_819056.1, 415 a.a. - 504 a.a.) was expressed in Wheat Germ, with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | Liquid |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | AEGHPRYTWYNLPYSILAIVEKYIQNLFIFESIHREPEKLSEDIQTLRVVTVCNGNTMPLASSCPKSGGVARDVA PQGKDMPPAANGNVC |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | OTOP1 otopetrin 1 [ Homo sapiens ] |
| Official Symbol | OTOP1 |
| Synonyms | OTOP1; otopetrin 1; otopetrin-1; MGC163302; MGC163304; |
| Gene ID | 133060 |
| mRNA Refseq | NM_177998 |
| Protein Refseq | NP_819056 |
| MIM | 607806 |
| UniProt ID | Q7RTM1 |
| Chromosome Location | 4p16.2 |
| ◆ Recombinant Proteins | ||
| OTOP1-12230M | Recombinant Mouse OTOP1 Protein | +Inquiry |
| OTOP1-4216R | Recombinant Rat OTOP1 Protein | +Inquiry |
| OTOP1-9838Z | Recombinant Zebrafish OTOP1 | +Inquiry |
| RFL24332MF | Recombinant Mouse Otopetrin-1(Otop1) Protein, His-Tagged | +Inquiry |
| OTOP1-1476H | Recombinant Human OTOP1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTOP1 Products
Required fields are marked with *
My Review for All OTOP1 Products
Required fields are marked with *



