Recombinant Human OTOR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OTOR-5210H |
Product Overview : | OTOR MS Standard C13 and N15-labeled recombinant protein (NP_064542) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the melanoma-inhibiting activity gene family. The encoded protein is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OTOR otoraplin [ Homo sapiens (human) ] |
Official Symbol | OTOR |
Synonyms | OTOR; otoraplin; FDP; MIAL; MIAL1; fibrocyte-derived protein; melanoma inhibitory activity-like protein; MGC126737; MGC126739; |
Gene ID | 56914 |
mRNA Refseq | NM_020157 |
Protein Refseq | NP_064542 |
MIM | 606067 |
UniProt ID | Q9NRC9 |
◆ Recombinant Proteins | ||
Otor-8009M | Recombinant Mouse Otor protein, His & T7-tagged | +Inquiry |
OTOR-210O | Recombinant Human OTOR Protein (111 aa) | +Inquiry |
Otor-4675M | Recombinant Mouse Otor protein, His-tagged | +Inquiry |
OTOR-1477H | Recombinant Human OTOR, GST-tagged | +Inquiry |
OTOR-063O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTOR Products
Required fields are marked with *
My Review for All OTOR Products
Required fields are marked with *
0
Inquiry Basket