Recombinant Human OTOR Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OTOR-5210H
Product Overview : OTOR MS Standard C13 and N15-labeled recombinant protein (NP_064542) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the melanoma-inhibiting activity gene family. The encoded protein is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness.
Molecular Mass : 14.3 kDa
AA Sequence : MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OTOR otoraplin [ Homo sapiens (human) ]
Official Symbol OTOR
Synonyms OTOR; otoraplin; FDP; MIAL; MIAL1; fibrocyte-derived protein; melanoma inhibitory activity-like protein; MGC126737; MGC126739;
Gene ID 56914
mRNA Refseq NM_020157
Protein Refseq NP_064542
MIM 606067
UniProt ID Q9NRC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OTOR Products

Required fields are marked with *

My Review for All OTOR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon