Recombinant Human OTUB2, His-tagged
| Cat.No. : | OTUB2-30525TH |
| Product Overview : | Recombinant full length protein, (amino acids 1-234) of Human OTUB2 with N terminal His tag; 254 amino acids, 29.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 234 amino acids |
| Description : | This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. |
| Conjugation : | HIS |
| Molecular Weight : | 29.400kDa inclusive of tags |
| Tissue specificity : | Widely expressed. Expressed at higher level in brain. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.29% Sodium chloride |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSETSFNLISEKCDILSILR DHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSY LESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNFFN AFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQI TALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLY KTSHYNILYAADKH |
| Sequence Similarities : | Belongs to the peptidase C65 family.Contains 1 OTU domain. |
| Gene Name | OTUB2 OTU domain, ubiquitin aldehyde binding 2 [ Homo sapiens ] |
| Official Symbol | OTUB2 |
| Synonyms | OTUB2; OTU domain, ubiquitin aldehyde binding 2; C14orf137, chromosome 14 open reading frame 137; ubiquitin thioesterase OTUB2; FLJ21916; MGC3102; |
| Gene ID | 78990 |
| mRNA Refseq | NM_023112 |
| Protein Refseq | NP_075601 |
| MIM | 608338 |
| Uniprot ID | Q96DC9 |
| Chromosome Location | 14q32.13-q32.2 |
| Function | cysteine-type peptidase activity; omega peptidase activity; peptidase activity; ubiquitin-specific protease activity; ubiquitin-specific protease activity; |
| ◆ Recombinant Proteins | ||
| OTUB2-64H | Recombinant Human OTUB2, His-tagged | +Inquiry |
| OTUB2-353H | Recombinant Human OTUB2 Protein | +Inquiry |
| OTUB2-30525TH | Recombinant Human OTUB2, His-tagged | +Inquiry |
| OTUB2-354H | Recombinant Human OTUB2 Protein, GST-tagged | +Inquiry |
| OTUB2-13HFL | Active Recombinant Full Length Human OTUB2 Protein, N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OTUB2-3515HCL | Recombinant Human OTUB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTUB2 Products
Required fields are marked with *
My Review for All OTUB2 Products
Required fields are marked with *



