| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
1-297 a.a. |
| Description : |
Homeobox Protein OTX2 is a number of the paired homeobox family of the Bicoid subfamily. OTX2 contains 1 homeobox DNA-binding domain and expresses in brain. OTX2 may play a role in the development of the brain and the sense organs. OTX2 positively regulate of gastrulation and embryonic development. Defects in OTX2 are the cause of microphthalmia syndromic type 5, which is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. It also causes pituitary hormone deficiency combined type 6. Combined pituitary hormone deficiency is defined as the impaired production of growth hormone and one or more of the other five anterior pituitary hormones. |
| Form : |
Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA Sequence : |
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALF AKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVS SESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQ GYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNS TTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVLLEHHHHHH |
| Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
