Recombinant Human OVOL1 protein, His-tagged
Cat.No. : | OVOL1-6755H |
Product Overview : | Recombinant Human OVOL1 protein(1-267 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-267 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | OVOL1 ovo-like 1(Drosophila) [ Homo sapiens ] |
Official Symbol | OVOL1 |
Synonyms | OVOL1; ovo-like 1(Drosophila); ovo (Drosophila) homolog like 1; putative transcription factor Ovo-like 1; ovo homolog-like 1; HOVO1; |
Gene ID | 5017 |
mRNA Refseq | NM_004561 |
Protein Refseq | NP_004552 |
MIM | 602313 |
UniProt ID | O14753 |
◆ Recombinant Proteins | ||
OVOL1-30527TH | Recombinant Human OVOL1 | +Inquiry |
OVOL1-12252M | Recombinant Mouse OVOL1 Protein | +Inquiry |
OVOL1-3264R | Recombinant Rhesus monkey OVOL1 Protein, His-tagged | +Inquiry |
OVOL1-3082R | Recombinant Rhesus Macaque OVOL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OVOL1-6755H | Recombinant Human OVOL1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVOL1-1263HCL | Recombinant Human OVOL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OVOL1 Products
Required fields are marked with *
My Review for All OVOL1 Products
Required fields are marked with *