Recombinant Human OXCT1 protein, T7/His-tagged
Cat.No. : | OXCT1-215H |
Product Overview : | Recombinant human OXCT1 cDNA (40 - 520aa, derived from BC009001) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 40-520 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSTSTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTG VKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFY TPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFN LPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDDVRERII KRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFS SDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKC TLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | OXCT1 3-oxoacid CoA transferase 1 [ Homo sapiens ] |
Official Symbol | OXCT1 |
Synonyms | OXCT1; 3-oxoacid CoA transferase 1; SCOT; SCOT-s; 3-oxoacid-CoA transferase 1; succinyl CoA:3-oxoacid CoA transferase; succinyl-CoA:3-ketoacid-CoA transferase; OXCT; |
Gene ID | 5019 |
mRNA Refseq | NM_000436 |
Protein Refseq | NP_000427 |
MIM | 601424 |
UniProt ID | P55809 |
Chromosome Location | 5p13 |
Pathway | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Ketone body metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Synthesis and Degradation of Ketone Bodies, organism-specific biosystem; |
Function | 3-oxoacid CoA-transferase activity; 3-oxoacid CoA-transferase activity; protein homodimerization activity; transferase activity; |
◆ Recombinant Proteins | ||
OXCT1-30531TH | Recombinant Human OXCT1 | +Inquiry |
OXCT1-3265R | Recombinant Rhesus monkey OXCT1 Protein, His-tagged | +Inquiry |
OXCT1-6447M | Recombinant Mouse OXCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OXCT1-3883R | Recombinant Rat OXCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OXCT1-769H | Recombinant Human OXCT1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OXCT1-3508HCL | Recombinant Human OXCT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OXCT1 Products
Required fields are marked with *
My Review for All OXCT1 Products
Required fields are marked with *