Recombinant Human OXNAD1 Protein (18-312 aa), His-SUMO-tagged
Cat.No. : | OXNAD1-1080H |
Product Overview : | Recombinant Human OXNAD1 Protein (18-312 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 18-312 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 49.2 kDa |
AA Sequence : | AIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | OXNAD1 oxidoreductase NAD-binding domain containing 1 [ Homo sapiens ] |
Official Symbol | OXNAD1 |
Gene ID | 92106 |
mRNA Refseq | NM_138381.3 |
Protein Refseq | NP_612390.1 |
UniProt ID | Q96HP4 |
◆ Recombinant Proteins | ||
OXNAD1-6451M | Recombinant Mouse OXNAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OXNAD1-6177Z | Recombinant Zebrafish OXNAD1 | +Inquiry |
OXNAD1-1080H | Recombinant Human OXNAD1 Protein (18-312 aa), His-SUMO-tagged | +Inquiry |
OXNAD1-3266R | Recombinant Rhesus monkey OXNAD1 Protein, His-tagged | +Inquiry |
OXNAD1-4434C | Recombinant Chicken OXNAD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OXNAD1-3505HCL | Recombinant Human OXNAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OXNAD1 Products
Required fields are marked with *
My Review for All OXNAD1 Products
Required fields are marked with *
0
Inquiry Basket