Recombinant Human OXNAD1 Protein (18-312 aa), His-SUMO-tagged
| Cat.No. : | OXNAD1-1080H |
| Product Overview : | Recombinant Human OXNAD1 Protein (18-312 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 18-312 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 49.2 kDa |
| AA Sequence : | AIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | OXNAD1 oxidoreductase NAD-binding domain containing 1 [ Homo sapiens ] |
| Official Symbol | OXNAD1 |
| Gene ID | 92106 |
| mRNA Refseq | NM_138381.3 |
| Protein Refseq | NP_612390.1 |
| UniProt ID | Q96HP4 |
| ◆ Recombinant Proteins | ||
| OXNAD1-3266R | Recombinant Rhesus monkey OXNAD1 Protein, His-tagged | +Inquiry |
| OXNAD1-12260M | Recombinant Mouse OXNAD1 Protein | +Inquiry |
| OXNAD1-4434C | Recombinant Chicken OXNAD1 | +Inquiry |
| OXNAD1-1704H | Recombinant Human OXNAD1 | +Inquiry |
| OXNAD1-1080H | Recombinant Human OXNAD1 Protein (18-312 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OXNAD1-3505HCL | Recombinant Human OXNAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OXNAD1 Products
Required fields are marked with *
My Review for All OXNAD1 Products
Required fields are marked with *
