Recombinant Human P2RX1 protein, His-tagged

• Cat.No.: P2RX1-3648H
• Product Overview: Recombinant Human P2RX1 protein(196-291 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 196-291 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: PRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNF
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: P2RX1 purinergic receptor P2X, ligand-gated ion channel, 1 [ Homo sapiens ]
• Official Symbol: P2RX1
• Synonyms: P2RX1; purinergic receptor P2X, ligand-gated ion channel, 1; P2X purinoceptor 1; P2X1; ATP receptor; P2X1 receptor; P2X receptor, subunit 1
• Gene ID: 5023
• mRNA Refseq: NM_002558
• Protein Refseq: NP_002549
• MIM: 600845
• UniProt ID: P51575