Recombinant Human PABPC1 protein, GST-tagged

Cat.No. : PABPC1-648H
Product Overview : Recombinant Human PABPC1(1 a.a. - 636 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-636 a.a.
Description : This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 97.1 kDa
AA Sequence : MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFD VIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEA AERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTD ESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ AHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNM PGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLN AQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PABPC1 poly(A) binding protein, cytoplasmic 1 [ Homo sapiens ]
Official Symbol PABPC1
Synonyms PABPC1; poly(A) binding protein, cytoplasmic 1; PAB1, PABPC2, poly(A) binding protein, cytoplasmic 2; polyadenylate-binding protein 1; PABP1; PABPL1; poly(A) binding protein, cytoplasmic 2; PAB1; PABP; PABPC2;
Gene ID 26986
mRNA Refseq NM_002568
Protein Refseq NP_002559
MIM 604679
UniProt ID P11940
Chromosome Location 8q22.2-q23
Pathway Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Destabilization of mRNA by AUF1 (hnRNP D0), organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Gene Expression, organism-specific biosystem;
Function RNA binding; nucleotide binding; poly(A) RNA binding; poly(A) RNA binding; protein C-terminus binding; protein binding; translation activator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PABPC1 Products

Required fields are marked with *

My Review for All PABPC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon