Recombinant Human PADI2, GST-tagged

Cat.No. : PADI2-186H
Product Overview : Recombinant Human PADI2(1 a.a. - 108 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes.
Molecular Mass : 37.62 kDa
AA Sequence : MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPST TLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PADI2 peptidyl arginine deiminase, type II [ Homo sapiens (human) ]
Official Symbol PADI2
Synonyms PADI2; PAD2; PDI2; PAD-H19; protein-arginine deiminase type-2; protein-arginine deiminase type II; NP_031391.2; EC 3.5.3.15; peptidyl arginine deiminase, type II
Gene ID 11240
mRNA Refseq NM_007365
Protein Refseq NP_031391
MIM 607935
UniProt ID Q9Y2J8
Chromosome Location 1p36.13
Pathway protein citrullination
Function calcium ion binding; estrogen receptor binding; protein-arginine deiminase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PADI2 Products

Required fields are marked with *

My Review for All PADI2 Products

Required fields are marked with *

0
cart-icon
0
compare icon