Recombinant Human PAEP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PAEP-6549H |
Product Overview : | PAEP MS Standard C13 and N15-labeled recombinant protein (NP_002562) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 20.6 kDa |
AA Sequence : | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PAEP progestagen-associated endometrial protein [ Homo sapiens (human) ] |
Official Symbol | PAEP |
Synonyms | PAEP; progestagen-associated endometrial protein; glycodelin; alpha uterine protein; GD; GdA; GdF; GdS; glycodelin A; glycodelin F; glycodelin S; MGC138509; MGC142288; PAEG; PEP; PP14; PP14 protein (placental protein 14); pregnancy associated endometrial alpha 2 globulin; progesterone associated endometrial protein; PEG; glycodelin-A; glycodelin-F; glycodelin-S; placental protein 14; progesterone-associated endometrial protein; pregnancy-associated endometrial alpha-2 globulin; pregnancy-associated endometrial alpha-2-globulin; progestagen-associated endometrial protein (placental protein 14, pregnancy-associated endometrial a; |
Gene ID | 5047 |
mRNA Refseq | NM_002571 |
Protein Refseq | NP_002562 |
MIM | 173310 |
UniProt ID | P09466 |
◆ Recombinant Proteins | ||
PAEP-3282R | Recombinant Rhesus monkey PAEP Protein, His-tagged | +Inquiry |
PAEP-354HF | Recombinant Full Length Human PAEP Protein | +Inquiry |
PAEP-0034B | Recombinant Bovine PAEP Protein (Lys17-Ile178), N-His-tagged | +Inquiry |
PAEP-3100R | Recombinant Rhesus Macaque PAEP Protein, His (Fc)-Avi-tagged | +Inquiry |
PAEP-4788H | Recombinant Human PAEP Protein (Met19-Phe158), N-GST tagged | +Inquiry |
◆ Native Proteins | ||
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAEP-3469HCL | Recombinant Human PAEP 293 Cell Lysate | +Inquiry |
PAEP-3470HCL | Recombinant Human PAEP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAEP Products
Required fields are marked with *
My Review for All PAEP Products
Required fields are marked with *