Recombinant Human PAFAH1B2 protein, GST-tagged
| Cat.No. : | PAFAH1B2-1210H |
| Product Overview : | Recombinant Human PAFAH1B2 protein(1-229 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-229 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PAFAH1B2 platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) [ Homo sapiens ] |
| Official Symbol | PAFAH1B2 |
| Synonyms | PAFAH1B2; platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa); platelet activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa , platelet activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa); platelet-activating factor acetylhydrolase IB subunit beta; PAF AH1b alpha 2 subunit; PAFAH subunit beta; PAF-AH subunit beta; PAF-AH 30 kDa subunit; PAF-AH1b alpha 2 subunit; PAF acetylhydrolase 30 kDa subunit; intracellular platelet-activating factor acetylhydrolase alpha 2 subunit; platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa); |
| Gene ID | 5049 |
| mRNA Refseq | NM_001184746 |
| Protein Refseq | NP_001171675 |
| MIM | 602508 |
| UniProt ID | P68402 |
| ◆ Recombinant Proteins | ||
| PAFAH1B2-4794H | Recombinant Human PAFAH1B2 protein, Avi-tagged, Biotinylated | +Inquiry |
| PAFAH1B2-12308M | Recombinant Mouse PAFAH1B2 Protein | +Inquiry |
| PAFAH1B2-6469M | Recombinant Mouse PAFAH1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PAFAH1B2-5268H | Recombinant Human PAFAH1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PAFAH1B2-2026HFL | Recombinant Full Length Human PAFAH1B2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAFAH1B2-3468HCL | Recombinant Human PAFAH1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAFAH1B2 Products
Required fields are marked with *
My Review for All PAFAH1B2 Products
Required fields are marked with *
