Recombinant Human PAFAH1B2 protein, GST-tagged

Cat.No. : PAFAH1B2-1210H
Product Overview : Recombinant Human PAFAH1B2 protein(1-229 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-229 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PAFAH1B2 platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) [ Homo sapiens ]
Official Symbol PAFAH1B2
Synonyms PAFAH1B2; platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa); platelet activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa , platelet activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa); platelet-activating factor acetylhydrolase IB subunit beta; PAF AH1b alpha 2 subunit; PAFAH subunit beta; PAF-AH subunit beta; PAF-AH 30 kDa subunit; PAF-AH1b alpha 2 subunit; PAF acetylhydrolase 30 kDa subunit; intracellular platelet-activating factor acetylhydrolase alpha 2 subunit; platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa);
Gene ID 5049
mRNA Refseq NM_001184746
Protein Refseq NP_001171675
MIM 602508
UniProt ID P68402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAFAH1B2 Products

Required fields are marked with *

My Review for All PAFAH1B2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon