Recombinant Human PAFAH1B2 protein, GST-tagged

• Cat.No.: PAFAH1B2-1210H
• Product Overview: Recombinant Human PAFAH1B2 protein(1-229 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-229 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PAFAH1B2 platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) [ Homo sapiens ]
• Official Symbol: PAFAH1B2
• Synonyms: PAFAH1B2; platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa); platelet activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa , platelet activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa); platelet-activating factor acetylhydrolase IB subunit beta; PAF AH1b alpha 2 subunit; PAFAH subunit beta; PAF-AH subunit beta; PAF-AH 30 kDa subunit; PAF-AH1b alpha 2 subunit; PAF acetylhydrolase 30 kDa subunit; intracellular platelet-activating factor acetylhydrolase alpha 2 subunit; platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa)
• Gene ID: 5049
• mRNA Refseq: NM_001184746
• Protein Refseq: NP_001171675
• MIM: 602508
• UniProt ID: P68402