Recombinant Human PAN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PAN3-5690H
Product Overview : PAN3 MS Standard C13 and N15-labeled recombinant protein (NP_787050) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PAN3 (Poly(A) Specific Ribonuclease Subunit PAN3) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and poly(A)-specific ribonuclease activity.
Molecular Mass : 76 kDa
AA Sequence : MDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNISQRRKTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PAN3 poly(A) specific ribonuclease subunit PAN3 [ Homo sapiens (human) ]
Official Symbol PAN3
Synonyms PAN3; PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae); PAB-dependent poly(A)-specific ribonuclease subunit 3; PABP-dependent poly(A) nuclease 3; PABP1-dependent poly A-specific ribonuclease subunit PAN3;
Gene ID 255967
mRNA Refseq NM_175854
Protein Refseq NP_787050
MIM 617448
UniProt ID Q58A45

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAN3 Products

Required fields are marked with *

My Review for All PAN3 Products

Required fields are marked with *

0
cart-icon